Scaffold Ga0268298_10088063

Overview

Basic Information

• Taxon OID: 3300028804
• Scaffold ID: Ga0268298_10088063
• Source Dataset Name: Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1883
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems

Source Dataset Sampling Location

• Location Name: Netherlands: Nijmegen, Gelderland
• Coordinates
  • Lat. (^o): 51.82
  • Long. (^o): 5.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268298_100880633	F069722	AGG	MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAVLQE