Scaffold Ga0265301_11028180

Overview

Basic Information

• Taxon OID: 3300028797
• Scaffold ID: Ga0265301_11028180
• Source Dataset Name: Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_04
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 593
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ct7Q419 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: Australia: Woodstock, Queensland
• Coordinates
  • Lat. (^o): -19.6574
  • Long. (^o): 146.8351

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098660	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265301_110281801	F098660	AGGAGG	MQMTMAEKRDLLERIRELALHDILNKEDRDTIFRVCMVACDRELAKLKKEE