Scaffold Ga0257139_1004648

Overview

Basic Information

• Taxon OID: 3300028620
• Scaffold ID: Ga0257139_1004648
• Source Dataset Name: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2493
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.68
  • Long. (^o): -124.009
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035608	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257139_10046486	F035608	N/A	LTPLLATVTSIYCPRLPENAALPAVSFFTRGGGSTPYIPGIPEPSVQFDCWANNPIDAREVYRALYDNLQGIQGKVVTVGPPTEIIWSAIEEVQGQDLVDMEIPNYFRTLAFFRFMIKAE