NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265294_10482849

Scaffold Ga0265294_10482849


Overview

Basic Information
Taxon OID3300028602 Open in IMG/M
Scaffold IDGa0265294_10482849 Open in IMG/M
Source Dataset NameGroundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)758
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Waterloo, Ontario
CoordinatesLat. (o)43.442Long. (o)-80.577Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065813Metagenome / Metatranscriptome127N
F073596Metagenome / Metatranscriptome120N
F095525Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0265294_104828491F095525AGGMKALTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK
Ga0265294_104828492F073596N/AMNVFEKIKLWFTSISKIVKFLTDTFGEAKILKDKQANFKDWVEFIIAFIKDALQYADEIAALSQAQPVQTKGQVIKAVKQDKKISTNYQTAFFKEKAQNFNK
Ga0265294_104828493F065813N/AMIPLISFFGWFDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIETPDVES

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.