Metagenome / Metatranscriptome Family F095525

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F095525
Family Type	Metagenome / Metatranscriptome
Number of Sequences	105
Average Sequence Length	41 residues
Representative Sequence	MKALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK
Number of Associated Samples	79
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	28.57 %
% of genes near scaffold ends (potentially truncated)	22.86 %
% of genes from short scaffolds (< 2000 bps)	92.38 %
Associated GOLD sequencing projects	62
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (69.524 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (59.048 % of family members)
Environment Ontology (ENVO)	Unclassified (95.238 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (69.524 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF07282	OrfB_Zn_ribbon	3.81
PF00078	RVT_1	0.95
PF00535	Glycos_transf_2	0.95

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
All Organisms	root	All Organisms	30.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
cellular organisms	root	All Organisms → cellular organisms	30.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	30.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	29.52 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	29.52 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	29.52 %
Actinomycetota incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	21.90 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	5.71 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.95 %
Candidatus Hakubanella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	21.90 %
Bacteroidetes bacterium ADurb.Bin139	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	5.71 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.95 %
Candidatus Hakubanella thermoalkaliphilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidetes bacterium ADurb.Bin139	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	5.71 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.95 %
Prevotellaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae	0.95 %
Bacteroidaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae	0.95 %
Candidatus Hakubanella thermoalkaliphilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidetes bacterium ADurb.Bin139	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	5.71 %
Prevotella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	0.95 %
Bacteroides	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	0.95 %
Galbibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Galbibacter	0.95 %
Candidatus Hakubanella thermoalkaliphilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus	0.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.52 %
Bacteroidetes bacterium ADurb.Bin139	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	5.71 %
Galbibacter marinus	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Galbibacter → Galbibacter marinus	0.95 %
Prevotella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	0.95 %
Bacteroides	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	0.95 %
Candidatus Hakubanella thermoalkaliphilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus	0.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2027040000\|ADn_FTWC1V109FTDY3	Not Available	502	Open in IMG/M
2027040000\|ADn_FUOFX6F01BI2AI	Not Available	548	Open in IMG/M
2027040000\|ADn_FUOFX6F02I19LZ	Not Available	532	Open in IMG/M
2070309008\|AD_consensus_for_cluster_2838	Not Available	557	Open in IMG/M
2070309008\|AD_consensus_for_cluster_29424	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	515	Open in IMG/M
2070309008\|AD_singleton_cluster_2180	Not Available	559	Open in IMG/M
3300002168\|JGI24712J26585_10064796	Not Available	1433	Open in IMG/M
3300002378\|JGI24502J29692_10065362	Not Available	1431	Open in IMG/M
3300002837\|bg3kmer60_1075310	Not Available	692	Open in IMG/M
3300002898\|draft_10180659	Not Available	1254	Open in IMG/M
3300003660\|LSCMMerge_1045147	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	672	Open in IMG/M
3300006381\|Ga0079102_1334306	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	570	Open in IMG/M
3300006598\|Ga0079098_1399675	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	877	Open in IMG/M
3300009542\|Ga0116234_1133551	Not Available	707	Open in IMG/M
3300009588\|Ga0116232_1186097	Not Available	510	Open in IMG/M
3300009589\|Ga0116233_1260464	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	852	Open in IMG/M
3300009670\|Ga0116183_1102384	Not Available	1510	Open in IMG/M
3300009670\|Ga0116183_1140465	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	1201	Open in IMG/M
3300009671\|Ga0123334_1252353	Not Available	783	Open in IMG/M
3300009673\|Ga0116185_1035301	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2841	Open in IMG/M
3300009675\|Ga0116149_1379706	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Galbibacter → Galbibacter marinus	592	Open in IMG/M
3300009676\|Ga0116187_1079085	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	1701	Open in IMG/M
3300009680\|Ga0123335_1308683	Not Available	759	Open in IMG/M
3300009680\|Ga0123335_1426145	Not Available	607	Open in IMG/M
3300009681\|Ga0116174_10271433	Not Available	825	Open in IMG/M
3300009681\|Ga0116174_10455768	Not Available	587	Open in IMG/M
3300009681\|Ga0116174_10584559	Not Available	502	Open in IMG/M
3300009685\|Ga0116142_10199875	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus	1022	Open in IMG/M
3300009685\|Ga0116142_10340773	Not Available	732	Open in IMG/M
3300009688\|Ga0116176_10564616	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	551	Open in IMG/M
3300009692\|Ga0116171_10112310	Not Available	1626	Open in IMG/M
3300009692\|Ga0116171_10265022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	947	Open in IMG/M
3300009693\|Ga0116141_10308336	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	834	Open in IMG/M
3300009694\|Ga0116170_10468857	Not Available	679	Open in IMG/M
3300009715\|Ga0116160_1235103	Not Available	704	Open in IMG/M
3300009720\|Ga0116159_1273330	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	660	Open in IMG/M
3300009767\|Ga0116161_1194228	Not Available	875	Open in IMG/M
3300009767\|Ga0116161_1240002	Not Available	755	Open in IMG/M
3300009772\|Ga0116162_10240567	Not Available	762	Open in IMG/M
3300009779\|Ga0116152_10542260	Not Available	529	Open in IMG/M
3300009781\|Ga0116178_10488172	Not Available	598	Open in IMG/M
3300009782\|Ga0116157_10357637	Not Available	763	Open in IMG/M
3300010310\|Ga0116235_1307109	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	627	Open in IMG/M
3300010344\|Ga0116243_10028896	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	5474	Open in IMG/M
3300010345\|Ga0116253_10180001	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	1415	Open in IMG/M
3300010346\|Ga0116239_10080813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2790	Open in IMG/M
3300010346\|Ga0116239_10295122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1140	Open in IMG/M
3300010346\|Ga0116239_10416019	Not Available	909	Open in IMG/M
3300010349\|Ga0116240_10024465	Not Available	5894	Open in IMG/M
3300010349\|Ga0116240_10649457	Not Available	689	Open in IMG/M
3300010349\|Ga0116240_10655873	Not Available	685	Open in IMG/M
3300010350\|Ga0116244_10423088	Not Available	887	Open in IMG/M
3300010351\|Ga0116248_10234580	Not Available	1470	Open in IMG/M
3300010351\|Ga0116248_10828565	Not Available	642	Open in IMG/M
3300010351\|Ga0116248_11060728	Not Available	546	Open in IMG/M
3300010356\|Ga0116237_10022070	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	8502	Open in IMG/M
3300012956\|Ga0154020_10424202	Not Available	1133	Open in IMG/M
3300014203\|Ga0172378_11330512	Not Available	505	Open in IMG/M
3300014204\|Ga0172381_11280428	Not Available	532	Open in IMG/M
3300014204\|Ga0172381_11396523	Not Available	505	Open in IMG/M
3300014205\|Ga0172380_10945719	Not Available	612	Open in IMG/M
3300014205\|Ga0172380_10983779	Not Available	598	Open in IMG/M
3300014206\|Ga0172377_10674956	Not Available	823	Open in IMG/M
3300015214\|Ga0172382_11109972	Not Available	518	Open in IMG/M
3300019217\|Ga0179946_1174516	Not Available	725	Open in IMG/M
3300019219\|Ga0179942_1213486	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	633	Open in IMG/M
3300019220\|Ga0179936_1035510	Not Available	1266	Open in IMG/M
3300019224\|Ga0180029_1013891	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	1864	Open in IMG/M
3300019224\|Ga0180029_1045828	Not Available	673	Open in IMG/M
3300019226\|Ga0179934_1106825	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	868	Open in IMG/M
3300019226\|Ga0179934_1152255	Not Available	554	Open in IMG/M
3300019231\|Ga0179935_1278028	Not Available	844	Open in IMG/M
3300019237\|Ga0180028_1366361	Not Available	591	Open in IMG/M
3300019239\|Ga0180030_1062303	Not Available	1412	Open in IMG/M
3300019239\|Ga0180030_1154206	Not Available	629	Open in IMG/M
3300025611\|Ga0209408_1079587	Not Available	893	Open in IMG/M
3300025677\|Ga0209719_1042190	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	1721	Open in IMG/M
3300025702\|Ga0209203_1154700	Not Available	716	Open in IMG/M
3300025708\|Ga0209201_1105825	Not Available	1002	Open in IMG/M
3300025724\|Ga0208196_1157221	Not Available	742	Open in IMG/M
3300025737\|Ga0208694_1220037	Not Available	598	Open in IMG/M
3300025740\|Ga0208940_1249037	Not Available	552	Open in IMG/M
3300025748\|Ga0208459_1177048	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	743	Open in IMG/M
3300025762\|Ga0208040_1231607	Not Available	627	Open in IMG/M
3300025847\|Ga0209607_1086042	Not Available	1403	Open in IMG/M
3300025856\|Ga0209604_1376434	Not Available	503	Open in IMG/M
3300025858\|Ga0209099_1077322	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	1521	Open in IMG/M
3300025858\|Ga0209099_1178437	Not Available	837	Open in IMG/M
3300025859\|Ga0209096_1065186	Not Available	1589	Open in IMG/M
3300025866\|Ga0208822_1202790	Not Available	713	Open in IMG/M
3300025867\|Ga0209098_1233516	Not Available	738	Open in IMG/M
3300025877\|Ga0208460_10168580	Not Available	862	Open in IMG/M
3300025882\|Ga0209097_10266724	Not Available	693	Open in IMG/M
3300026290\|Ga0209510_1258631	Not Available	520	Open in IMG/M
3300026311\|Ga0209723_1025179	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	3557	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1039839	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2636	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1150882	Not Available	959	Open in IMG/M
(restricted) 3300028570\|Ga0255341_1299794	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	591	Open in IMG/M
3300028602\|Ga0265294_10482849	Not Available	758	Open in IMG/M
3300028602\|Ga0265294_10552758	Not Available	687	Open in IMG/M
3300028602\|Ga0265294_10605830	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	643	Open in IMG/M
3300028603\|Ga0265293_10544446	Not Available	657	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1067433	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	1787	Open in IMG/M
3300029288\|Ga0265297_10882893	Not Available	540	Open in IMG/M
3300033166\|Ga0334900_1005725	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139	7806	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	95.24%
Environmental	Environmental	4.76%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	65.71%
Bioreactor	Engineered → Bioreactor	14.29%
Solid Waste	Engineered → Solid Waste	7.62%
Aquatic	Environmental → Aquatic	4.76%
Built Environment	Engineered → Built Environment	3.81%
Biotransformation	Engineered → Biotransformation	2.86%
Unclassified	Engineered → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	59.05%
Anaerobic	Engineered → Bioreactor → Anaerobic	14.29%
Landfill	Engineered → Solid Waste → Landfill	7.62%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	5.71%
Freshwater	Environmental → Aquatic → Freshwater	4.76%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	3.81%
Mixed Alcohol Bioreactor	Engineered → Biotransformation → Mixed Alcohol Bioreactor	1.90%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.95%
Unclassified	Engineered → Unclassified → Unclassified	0.95%
Unclassified	Engineered → Biotransformation → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	59.05%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	14.29%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	7.62%
Dissolved Organics (Anaerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic)	5.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	4.76%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	3.81%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified	1.90%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.95%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified	0.95%
Unclassified	Engineered → Biotransformation → Unclassified → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	59.05%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	14.29%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	7.62%
Unclassified	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified	5.71%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	3.81%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	3.81%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified	1.90%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water	0.95%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.95%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified → Unclassified	0.95%
Unclassified	Engineered → Biotransformation → Unclassified → Unclassified → Unclassified	0.95%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	59.05%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	13.33%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	7.62%
Wastewater	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater	5.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	3.81%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	3.81%
Biogas Fermentantion	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion	1.90%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water	0.95%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.95%
Biogas Fermenter	Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter	0.95%
Sludge	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge	0.95%
Biogas Reactor	Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor	0.95%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2027040000	Wastewater viral communities from wastewater treatment facility in Singapore - AD-no assembly	Engineered	Open in IMG/M
2070309008	Wastewater viral communities from wastewater treatment facility in Singapore - AD-deduplicated data	Engineered	Open in IMG/M
3300002168	Biogas fermentation microbial communities from Germany - Plant 3 DNA2	Engineered	Open in IMG/M
3300002378	Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300002837	Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer	Engineered	Open in IMG/M
3300002898	Metagenome Biopara biogasfermenter May 2013 pooled	Engineered	Open in IMG/M
3300003660	Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged)	Environmental	Open in IMG/M
3300006381	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006598	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009542	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009588	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009589	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009670	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG	Engineered	Open in IMG/M
3300009671	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA	Engineered	Open in IMG/M
3300009673	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG	Engineered	Open in IMG/M
3300009675	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG	Engineered	Open in IMG/M
3300009676	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG	Engineered	Open in IMG/M
3300009680	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA	Engineered	Open in IMG/M
3300009681	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG	Engineered	Open in IMG/M
3300009685	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG	Engineered	Open in IMG/M
3300009688	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG	Engineered	Open in IMG/M
3300009692	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG	Engineered	Open in IMG/M
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered	Open in IMG/M
3300009694	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG	Engineered	Open in IMG/M
3300009715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG	Engineered	Open in IMG/M
3300009720	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG	Engineered	Open in IMG/M
3300009767	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG	Engineered	Open in IMG/M
3300009772	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG	Engineered	Open in IMG/M
3300009779	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG	Engineered	Open in IMG/M
3300009781	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300010310	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300010344	AD_JPASca	Engineered	Open in IMG/M
3300010345	AD_JPNAca2	Engineered	Open in IMG/M
3300010346	AD_USMOca	Engineered	Open in IMG/M
3300010349	AD_HKTAca	Engineered	Open in IMG/M
3300010350	AD_HKSTca	Engineered	Open in IMG/M
3300010351	AD_USPNca	Engineered	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300012956	Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG	Engineered	Open in IMG/M
3300014203	Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG	Environmental	Open in IMG/M
3300014204	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG	Engineered	Open in IMG/M
3300014205	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG	Engineered	Open in IMG/M
3300014206	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG	Engineered	Open in IMG/M
3300015214	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG	Engineered	Open in IMG/M
3300019217	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019219	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC052_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019220	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019224	Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-B RNA time zero (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019226	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019231	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019237	Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019239	Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300025611	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025677	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025702	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025724	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025737	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025740	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025748	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025762	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025847	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025856	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025858	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025859	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025866	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025867	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025877	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025882	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026290	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300026311	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300028564 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18	Engineered	Open in IMG/M
3300028570 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12	Engineered	Open in IMG/M
3300028602	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3	Environmental	Open in IMG/M
3300028603	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R	Engineered	Open in IMG/M
3300028677 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22	Engineered	Open in IMG/M
3300029288	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91	Engineered	Open in IMG/M
3300033166	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_08-R3	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
AD_na_3382080	2027040000	Wastewater	MKTLTDIGLVALGLVVGVVVGQLLQYNKHRIENFYKQVKKEIR
AD_na_6386020	2027040000	Wastewater	MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINRLKKK
AD_na_2979680	2027040000	Wastewater	MKALTDIGLVALGLVAGVVVGQLLQYNKHRIEDFINKLKKK
AD_01029870	2070309008	Wastewater	MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINKLKKK
AD_01066110	2070309008	Wastewater	MKAFTDIGLVALGLVVGVVVGQLLQYNKHRIENFINRXKKKXXXXX
AD_02457200	2070309008	Wastewater	MKPVTAIWLVALGLVAGVVVGQLLQYNQINIQNIIKKIFGK
JGI24712J26585_100647962	3300002168	Biogas Fermentantion	MKALTDIGLVALGLVAGVVVGQLLQYHQKRIENFINKLKKK*
JGI24502J29692_100653622	3300002378	Biogas Fermentantion	MKELTDIALVALGLVVGVVVGQLLQYNKKRIENFINKLKKK*
bg3kmer60_10753103	3300002837	Biogas Reactor	NVTAIWLVALGLVVGVVVGQLLQYNKHRIENFINKLKKKIK*
draft_101806593	3300002898	Biogas Fermenter	MKAFTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK*
LSCMMerge_10451472	3300003660	Coalbed Water	MKPVTAIWLVALGLVVGVVIGQLLQYNKHRIENFINKLKKK*
Ga0079102_13343062	3300006381	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYNQKRIEEFINKSPGG
Ga0079098_13996752	3300006598	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGIVIGQCLQYHQKRIEEFVNKIFKKK*
Ga0116234_11335511	3300009542	Anaerobic Biogas Reactor	MKPVTAIWLVALGLVVGVVIGQLLQYHQINLLETIKKIFKR
Ga0116232_11860971	3300009588	Anaerobic Biogas Reactor	MKHLTDIGLVALGLVVGVVLGQLLHYHQINLLETIKNIFKR*
Ga0116233_12604642	3300009589	Anaerobic Biogas Reactor	MKELTDIGLVAFGVVVGVVLGQLLQYNKHRIENFINKLKKK*
Ga0116183_11023841	3300009670	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI*
Ga0116183_11404653	3300009670	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKKNNE*
Ga0123334_12523533	3300009671	Anaerobic Biogas Reactor	MKTLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR*
Ga0116185_10353015	3300009673	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK*
Ga0116149_13797061	3300009675	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYNKQRIENFINKLKKKIK*
Ga0116187_10790852	3300009676	Anaerobic Digestor Sludge	MKTLTDIALVALGLVAGVVIGQLLQYHQINIQNIIKKIFGK*
Ga0123335_13086834	3300009680	Anaerobic Biogas Reactor	RAMKALTDIGLVALGLVVGIPVGACLQYNKQRIEEFINKLKKK*
Ga0123335_14261452	3300009680	Anaerobic Biogas Reactor	MKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR*
Ga0116174_102714332	3300009681	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVVGQLLQYHQKRIEEFVNKIFKKKIK*
Ga0116174_104557683	3300009681	Anaerobic Digestor Sludge	GLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI*
Ga0116174_105845591	3300009681	Anaerobic Digestor Sludge	LSAYFKAMKALTDIALVALGLVVGVVVGQLLQYNKHRIENFINKLKKK*
Ga0116142_101998752	3300009685	Anaerobic Digestor Sludge	LVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK*
Ga0116142_103407731	3300009685	Anaerobic Digestor Sludge	TDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK*
Ga0116176_105646161	3300009688	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNKKRVENFINKLKKK
Ga0116171_101123104	3300009692	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGVVLGQLLQYHQINIQNIIKKIFKKK*
Ga0116171_102650222	3300009692	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK*
Ga0116141_103083362	3300009693	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGIVIGQCLQYHQINILEIIKKLFTK*
Ga0116170_104688573	3300009694	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGVVVGQLLQYHKRSIENFI
Ga0116160_12351033	3300009715	Anaerobic Digestor Sludge	GRMKALTDIALVALGLVVGVVVGQLLQYHQINIQNIIKKIFKKK*
Ga0116159_12733303	3300009720	Anaerobic Digestor Sludge	GLVALGLVAGVVIGQLLQYNQINIQNIIKKIFKKK*
Ga0116161_11942284	3300009767	Anaerobic Digestor Sludge	MKELTDIGLVALGLVVGVVVGQLLQYNQINIQNIIKKIFKKK*
Ga0116161_12400021	3300009767	Anaerobic Digestor Sludge	MKTLTDIALVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK*
Ga0116162_102405672	3300009772	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGVVVGQLLQYNKHRIEDFINKLKKK*
Ga0116152_105422602	3300009779	Anaerobic Digestor Sludge	MKHLTDIGLVALGLVAGVVVGQLLQYHQKRIEEFINKIFKKK*
Ga0116178_104881721	3300009781	Anaerobic Digestor Sludge	MKHLTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK*
Ga0116157_103576372	3300009782	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINKLKKK*
Ga0116235_13071092	3300010310	Anaerobic Biogas Reactor	MKPVTAIWLVALGLVVGIVIGQCLQYNKKRIENFTNKLKKK*
Ga0116243_100288963	3300010344	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK*
Ga0116253_101800013	3300010345	Anaerobic Digestor Sludge	MKTLTAFMWVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK*
Ga0116239_100808133	3300010346	Anaerobic Digestor Sludge	MKELTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK*
Ga0116239_102951222	3300010346	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNQKRIEEFVNKIFKKKIK*
Ga0116239_104160192	3300010346	Anaerobic Digestor Sludge	AYFKAMKPVTVIWLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK*
Ga0116240_100244654	3300010349	Anaerobic Digestor Sludge	MRALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK*
Ga0116240_106494573	3300010349	Anaerobic Digestor Sludge	PVTAIWLVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK*
Ga0116240_106558733	3300010349	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK*
Ga0116244_104230884	3300010350	Anaerobic Digestor Sludge	MKALTDIGLVAFGLVVGVVVGQLLQYHQINIMEIIKKIFKK*
Ga0116248_102345803	3300010351	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVAGVVIGQCLQYNKQRIENFINKLKKK*
Ga0116248_108285651	3300010351	Anaerobic Digestor Sludge	VALGLVVGIVIGQCLQYNKQRIENFINKLKKKNNE*
Ga0116248_110607283	3300010351	Anaerobic Digestor Sludge	PVTAIWLVALGLVVGVVVGQLLQYHQKRIEEFVNKIFKKKIK*
Ga0116237_100220702	3300010356	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK*
Ga0154020_104242024	3300012956	Active Sludge	MKAFTDIGLVALGLVVGVVLGQLLQYHQKRIEEFINKIFKKK*
Ga0172378_113305122	3300014203	Groundwater	MKALTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR*
Ga0172381_112804281	3300014204	Landfill Leachate	MKAFTDIALVALGLVAGVVVGKLLQYNKKRIENFINKLKKK*
Ga0172381_113965232	3300014204	Landfill Leachate	TAIWLVALGLVAGVVIGQLLQYHQINLLETIKKIFKR*
Ga0172380_109457193	3300014205	Landfill Leachate	MKHLTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKL
Ga0172380_109837792	3300014205	Landfill Leachate	MKPVTAIWLVALGLVAGVVVGQLLQYNKKRIENFINKLKKK*
Ga0172377_106749562	3300014206	Landfill Leachate	MKALTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK*
Ga0172382_111099722	3300015214	Landfill Leachate	MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFVNKIFKKKIR*
Ga0179946_11745163	3300019217	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK
Ga0179942_12134862	3300019219	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKR
Ga0179936_10355102	3300019220	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK
Ga0180029_10138912	3300019224	Anaerobic Biogas Reactor	MKPVTAIWLVALGLVAGVVVGQLLQYHQINLLETIKKIFKR
Ga0180029_10458282	3300019224	Anaerobic Biogas Reactor	MKTLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKNIFKR
Ga0179934_11068252	3300019226	Anaerobic Digestor Sludge	MKALTDIGLVAFGLVVGVVVGQLLQYNKHRIENFINKLKKKYYERI
Ga0179934_11522551	3300019226	Anaerobic Digestor Sludge	MKELTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK
Ga0179935_12780281	3300019231	Anaerobic Digestor Sludge	MKHLTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK
Ga0180028_13663612	3300019237	Anaerobic Biogas Reactor	MKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR
Ga0180030_10623035	3300019239	Anaerobic Biogas Reactor	MKELTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR
Ga0180030_11542062	3300019239	Anaerobic Biogas Reactor	MKALTDIGLVALGLVVGVVVGQLLHHFKPFLDKIFKNKHLTKI
Ga0209408_10795874	3300025611	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK
Ga0209719_10421906	3300025677	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK
Ga0209203_11547001	3300025702	Anaerobic Digestor Sludge	CFKTMRALTDIGLVALGLVVGVVIGQLLHYHQINLLETIKKIFKR
Ga0209201_11058252	3300025708	Anaerobic Digestor Sludge	MKELTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK
Ga0208196_11572213	3300025724	Anaerobic Digestor Sludge	MKELTDIALVALGLVAGVVIGQLLQYHQINIQNIIKKIFGK
Ga0208694_12200372	3300025737	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI
Ga0208940_12490372	3300025740	Anaerobic Digestor Sludge	MKTLTAFMWVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK
Ga0208459_11770482	3300025748	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVAGVVIGQCLQYNKQRIENFINKLKKK
Ga0208040_12316071	3300025762	Anaerobic Digestor Sludge	DIALVALGLVVGIPVGACLQYNKHRIENFINKLKKK
Ga0209607_10860424	3300025847	Anaerobic Digestor Sludge	MKELTDIALVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK
Ga0209604_13764342	3300025856	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGIVIGQCLQYHQINILEIIKKLFTK
Ga0209099_10773221	3300025858	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK
Ga0209099_11784371	3300025858	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGVVLGQLLQYHQINIQNIIKKIFKKK
Ga0209096_10651861	3300025859	Anaerobic Digestor Sludge	MKALTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK
Ga0208822_12027903	3300025866	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGIVIGQCLQYHQKRIEEFVNKIFKKK
Ga0209098_12335162	3300025867	Anaerobic Digestor Sludge	MKTLTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK
Ga0208460_101685802	3300025877	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGVVVGQLLQYNQKRIEEFINKIFKKKI
Ga0209097_102667243	3300025882	Anaerobic Digestor Sludge	MKPVTAIWLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK
Ga0209510_12586311	3300026290	Anaerobic Biogas Reactor	KTMKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR
Ga0209723_10251796	3300026311	Anaerobic Biogas Reactor	MKALTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK
(restricted) Ga0255344_10398392	3300028564	Wastewater	MKPVTAIWLVALGLVVGIVIGQLLQYNKQRIENFINKLKKK
(restricted) Ga0255344_11508821	3300028564	Wastewater	MKALTDIGLVAFGLVVGVVLGQLLQYNRHRIENFINKLKKKNNE
(restricted) Ga0255341_12997942	3300028570	Wastewater	MKSVTAIWLVALGLVVGVVVGQLLQYNKHRIENFINKLKKKNNE
Ga0265294_104828491	3300028602	Groundwater	MKALTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK
Ga0265294_105527583	3300028602	Groundwater	MKPVTAIWLVALGLVAGVVIGQLLQYHQINLLETIKNIFKR
Ga0265294_106058302	3300028602	Groundwater	MKHLTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI
Ga0265293_105444463	3300028603	Landfill Leachate	LVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI
(restricted) Ga0255346_10674334	3300028677	Wastewater	MKPVTAIWLVALGLVVGVVVGQLLQYNKQRIENFINKLKKK
Ga0265297_108828932	3300029288	Landfill Leachate	MKHLTDIGLVALGLVVGVVVGQLLQYHQKRIEEFINKIFKKKI
Ga0334900_10057251	3300033166	Sludge	MKELTDIGLVAFGLVVGVVLGQLLHYHQINLLETIK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters