| Basic Information | |
|---|---|
| Family ID | F095525 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 28.57 % |
| % of genes near scaffold ends (potentially truncated) | 22.86 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.524 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (59.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF07282 | OrfB_Zn_ribbon | 3.81 |
| PF00078 | RVT_1 | 0.95 |
| PF00535 | Glycos_transf_2 | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.52 % |
| All Organisms | root | All Organisms | 30.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2027040000|ADn_FTWC1V109FTDY3 | Not Available | 502 | Open in IMG/M |
| 2027040000|ADn_FUOFX6F01BI2AI | Not Available | 548 | Open in IMG/M |
| 2027040000|ADn_FUOFX6F02I19LZ | Not Available | 532 | Open in IMG/M |
| 2070309008|AD_consensus_for_cluster_2838 | Not Available | 557 | Open in IMG/M |
| 2070309008|AD_consensus_for_cluster_29424 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 515 | Open in IMG/M |
| 2070309008|AD_singleton_cluster_2180 | Not Available | 559 | Open in IMG/M |
| 3300002168|JGI24712J26585_10064796 | Not Available | 1433 | Open in IMG/M |
| 3300002378|JGI24502J29692_10065362 | Not Available | 1431 | Open in IMG/M |
| 3300002837|bg3kmer60_1075310 | Not Available | 692 | Open in IMG/M |
| 3300002898|draft_10180659 | Not Available | 1254 | Open in IMG/M |
| 3300003660|LSCMMerge_1045147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 672 | Open in IMG/M |
| 3300006381|Ga0079102_1334306 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 570 | Open in IMG/M |
| 3300006598|Ga0079098_1399675 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 877 | Open in IMG/M |
| 3300009542|Ga0116234_1133551 | Not Available | 707 | Open in IMG/M |
| 3300009588|Ga0116232_1186097 | Not Available | 510 | Open in IMG/M |
| 3300009589|Ga0116233_1260464 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 852 | Open in IMG/M |
| 3300009670|Ga0116183_1102384 | Not Available | 1510 | Open in IMG/M |
| 3300009670|Ga0116183_1140465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1201 | Open in IMG/M |
| 3300009671|Ga0123334_1252353 | Not Available | 783 | Open in IMG/M |
| 3300009673|Ga0116185_1035301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2841 | Open in IMG/M |
| 3300009675|Ga0116149_1379706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Galbibacter → Galbibacter marinus | 592 | Open in IMG/M |
| 3300009676|Ga0116187_1079085 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1701 | Open in IMG/M |
| 3300009680|Ga0123335_1308683 | Not Available | 759 | Open in IMG/M |
| 3300009680|Ga0123335_1426145 | Not Available | 607 | Open in IMG/M |
| 3300009681|Ga0116174_10271433 | Not Available | 825 | Open in IMG/M |
| 3300009681|Ga0116174_10455768 | Not Available | 587 | Open in IMG/M |
| 3300009681|Ga0116174_10584559 | Not Available | 502 | Open in IMG/M |
| 3300009685|Ga0116142_10199875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetota incertae sedis → Candidatus Hakubanella → Candidatus Hakubanella thermoalkaliphilus | 1022 | Open in IMG/M |
| 3300009685|Ga0116142_10340773 | Not Available | 732 | Open in IMG/M |
| 3300009688|Ga0116176_10564616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 551 | Open in IMG/M |
| 3300009692|Ga0116171_10112310 | Not Available | 1626 | Open in IMG/M |
| 3300009692|Ga0116171_10265022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 947 | Open in IMG/M |
| 3300009693|Ga0116141_10308336 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 834 | Open in IMG/M |
| 3300009694|Ga0116170_10468857 | Not Available | 679 | Open in IMG/M |
| 3300009715|Ga0116160_1235103 | Not Available | 704 | Open in IMG/M |
| 3300009720|Ga0116159_1273330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 660 | Open in IMG/M |
| 3300009767|Ga0116161_1194228 | Not Available | 875 | Open in IMG/M |
| 3300009767|Ga0116161_1240002 | Not Available | 755 | Open in IMG/M |
| 3300009772|Ga0116162_10240567 | Not Available | 762 | Open in IMG/M |
| 3300009779|Ga0116152_10542260 | Not Available | 529 | Open in IMG/M |
| 3300009781|Ga0116178_10488172 | Not Available | 598 | Open in IMG/M |
| 3300009782|Ga0116157_10357637 | Not Available | 763 | Open in IMG/M |
| 3300010310|Ga0116235_1307109 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 627 | Open in IMG/M |
| 3300010344|Ga0116243_10028896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5474 | Open in IMG/M |
| 3300010345|Ga0116253_10180001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1415 | Open in IMG/M |
| 3300010346|Ga0116239_10080813 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2790 | Open in IMG/M |
| 3300010346|Ga0116239_10295122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1140 | Open in IMG/M |
| 3300010346|Ga0116239_10416019 | Not Available | 909 | Open in IMG/M |
| 3300010349|Ga0116240_10024465 | Not Available | 5894 | Open in IMG/M |
| 3300010349|Ga0116240_10649457 | Not Available | 689 | Open in IMG/M |
| 3300010349|Ga0116240_10655873 | Not Available | 685 | Open in IMG/M |
| 3300010350|Ga0116244_10423088 | Not Available | 887 | Open in IMG/M |
| 3300010351|Ga0116248_10234580 | Not Available | 1470 | Open in IMG/M |
| 3300010351|Ga0116248_10828565 | Not Available | 642 | Open in IMG/M |
| 3300010351|Ga0116248_11060728 | Not Available | 546 | Open in IMG/M |
| 3300010356|Ga0116237_10022070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 8502 | Open in IMG/M |
| 3300012956|Ga0154020_10424202 | Not Available | 1133 | Open in IMG/M |
| 3300014203|Ga0172378_11330512 | Not Available | 505 | Open in IMG/M |
| 3300014204|Ga0172381_11280428 | Not Available | 532 | Open in IMG/M |
| 3300014204|Ga0172381_11396523 | Not Available | 505 | Open in IMG/M |
| 3300014205|Ga0172380_10945719 | Not Available | 612 | Open in IMG/M |
| 3300014205|Ga0172380_10983779 | Not Available | 598 | Open in IMG/M |
| 3300014206|Ga0172377_10674956 | Not Available | 823 | Open in IMG/M |
| 3300015214|Ga0172382_11109972 | Not Available | 518 | Open in IMG/M |
| 3300019217|Ga0179946_1174516 | Not Available | 725 | Open in IMG/M |
| 3300019219|Ga0179942_1213486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 633 | Open in IMG/M |
| 3300019220|Ga0179936_1035510 | Not Available | 1266 | Open in IMG/M |
| 3300019224|Ga0180029_1013891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1864 | Open in IMG/M |
| 3300019224|Ga0180029_1045828 | Not Available | 673 | Open in IMG/M |
| 3300019226|Ga0179934_1106825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | 868 | Open in IMG/M |
| 3300019226|Ga0179934_1152255 | Not Available | 554 | Open in IMG/M |
| 3300019231|Ga0179935_1278028 | Not Available | 844 | Open in IMG/M |
| 3300019237|Ga0180028_1366361 | Not Available | 591 | Open in IMG/M |
| 3300019239|Ga0180030_1062303 | Not Available | 1412 | Open in IMG/M |
| 3300019239|Ga0180030_1154206 | Not Available | 629 | Open in IMG/M |
| 3300025611|Ga0209408_1079587 | Not Available | 893 | Open in IMG/M |
| 3300025677|Ga0209719_1042190 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1721 | Open in IMG/M |
| 3300025702|Ga0209203_1154700 | Not Available | 716 | Open in IMG/M |
| 3300025708|Ga0209201_1105825 | Not Available | 1002 | Open in IMG/M |
| 3300025724|Ga0208196_1157221 | Not Available | 742 | Open in IMG/M |
| 3300025737|Ga0208694_1220037 | Not Available | 598 | Open in IMG/M |
| 3300025740|Ga0208940_1249037 | Not Available | 552 | Open in IMG/M |
| 3300025748|Ga0208459_1177048 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 743 | Open in IMG/M |
| 3300025762|Ga0208040_1231607 | Not Available | 627 | Open in IMG/M |
| 3300025847|Ga0209607_1086042 | Not Available | 1403 | Open in IMG/M |
| 3300025856|Ga0209604_1376434 | Not Available | 503 | Open in IMG/M |
| 3300025858|Ga0209099_1077322 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1521 | Open in IMG/M |
| 3300025858|Ga0209099_1178437 | Not Available | 837 | Open in IMG/M |
| 3300025859|Ga0209096_1065186 | Not Available | 1589 | Open in IMG/M |
| 3300025866|Ga0208822_1202790 | Not Available | 713 | Open in IMG/M |
| 3300025867|Ga0209098_1233516 | Not Available | 738 | Open in IMG/M |
| 3300025877|Ga0208460_10168580 | Not Available | 862 | Open in IMG/M |
| 3300025882|Ga0209097_10266724 | Not Available | 693 | Open in IMG/M |
| 3300026290|Ga0209510_1258631 | Not Available | 520 | Open in IMG/M |
| 3300026311|Ga0209723_1025179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3557 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1039839 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2636 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1150882 | Not Available | 959 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1299794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 591 | Open in IMG/M |
| 3300028602|Ga0265294_10482849 | Not Available | 758 | Open in IMG/M |
| 3300028602|Ga0265294_10552758 | Not Available | 687 | Open in IMG/M |
| 3300028602|Ga0265294_10605830 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 643 | Open in IMG/M |
| 3300028603|Ga0265293_10544446 | Not Available | 657 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1067433 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1787 | Open in IMG/M |
| 3300029288|Ga0265297_10882893 | Not Available | 540 | Open in IMG/M |
| 3300033166|Ga0334900_1005725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 7806 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 59.05% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 13.33% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 7.62% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater | 5.71% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.81% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 3.81% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 1.90% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.95% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.95% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 0.95% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 0.95% |
| Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2027040000 | Wastewater viral communities from wastewater treatment facility in Singapore - AD-no assembly | Engineered | Open in IMG/M |
| 2070309008 | Wastewater viral communities from wastewater treatment facility in Singapore - AD-deduplicated data | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002378 | Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003660 | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged) | Environmental | Open in IMG/M |
| 3300006381 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006598 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009542 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009588 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009589 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300010310 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300019217 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019219 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC052_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019220 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019224 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019237 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019239 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025702 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025877 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025882 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300033166 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_08-R3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AD_na_3382080 | 2027040000 | Wastewater | MKTLTDIGLVALGLVVGVVVGQLLQYNKHRIENFYKQVKKEIR |
| AD_na_6386020 | 2027040000 | Wastewater | MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINRLKKK |
| AD_na_2979680 | 2027040000 | Wastewater | MKALTDIGLVALGLVAGVVVGQLLQYNKHRIEDFINKLKKK |
| AD_01029870 | 2070309008 | Wastewater | MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINKLKKK |
| AD_01066110 | 2070309008 | Wastewater | MKAFTDIGLVALGLVVGVVVGQLLQYNKHRIENFINRXKKKXXXXX |
| AD_02457200 | 2070309008 | Wastewater | MKPVTAIWLVALGLVAGVVVGQLLQYNQINIQNIIKKIFGK |
| JGI24712J26585_100647962 | 3300002168 | Biogas Fermentantion | MKALTDIGLVALGLVAGVVVGQLLQYHQKRIENFINKLKKK* |
| JGI24502J29692_100653622 | 3300002378 | Biogas Fermentantion | MKELTDIALVALGLVVGVVVGQLLQYNKKRIENFINKLKKK* |
| bg3kmer60_10753103 | 3300002837 | Biogas Reactor | NVTAIWLVALGLVVGVVVGQLLQYNKHRIENFINKLKKKIK* |
| draft_101806593 | 3300002898 | Biogas Fermenter | MKAFTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK* |
| LSCMMerge_10451472 | 3300003660 | Coalbed Water | MKPVTAIWLVALGLVVGVVIGQLLQYNKHRIENFINKLKKK* |
| Ga0079102_13343062 | 3300006381 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYNQKRIEEFINKSPGG |
| Ga0079098_13996752 | 3300006598 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGIVIGQCLQYHQKRIEEFVNKIFKKK* |
| Ga0116234_11335511 | 3300009542 | Anaerobic Biogas Reactor | MKPVTAIWLVALGLVVGVVIGQLLQYHQINLLETIKKIFKR |
| Ga0116232_11860971 | 3300009588 | Anaerobic Biogas Reactor | MKHLTDIGLVALGLVVGVVLGQLLHYHQINLLETIKNIFKR* |
| Ga0116233_12604642 | 3300009589 | Anaerobic Biogas Reactor | MKELTDIGLVAFGVVVGVVLGQLLQYNKHRIENFINKLKKK* |
| Ga0116183_11023841 | 3300009670 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI* |
| Ga0116183_11404653 | 3300009670 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKKNNE* |
| Ga0123334_12523533 | 3300009671 | Anaerobic Biogas Reactor | MKTLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR* |
| Ga0116185_10353015 | 3300009673 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK* |
| Ga0116149_13797061 | 3300009675 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYNKQRIENFINKLKKKIK* |
| Ga0116187_10790852 | 3300009676 | Anaerobic Digestor Sludge | MKTLTDIALVALGLVAGVVIGQLLQYHQINIQNIIKKIFGK* |
| Ga0123335_13086834 | 3300009680 | Anaerobic Biogas Reactor | RAMKALTDIGLVALGLVVGIPVGACLQYNKQRIEEFINKLKKK* |
| Ga0123335_14261452 | 3300009680 | Anaerobic Biogas Reactor | MKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR* |
| Ga0116174_102714332 | 3300009681 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVVGQLLQYHQKRIEEFVNKIFKKKIK* |
| Ga0116174_104557683 | 3300009681 | Anaerobic Digestor Sludge | GLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI* |
| Ga0116174_105845591 | 3300009681 | Anaerobic Digestor Sludge | LSAYFKAMKALTDIALVALGLVVGVVVGQLLQYNKHRIENFINKLKKK* |
| Ga0116142_101998752 | 3300009685 | Anaerobic Digestor Sludge | LVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK* |
| Ga0116142_103407731 | 3300009685 | Anaerobic Digestor Sludge | TDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK* |
| Ga0116176_105646161 | 3300009688 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNKKRVENFINKLKKK |
| Ga0116171_101123104 | 3300009692 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGVVLGQLLQYHQINIQNIIKKIFKKK* |
| Ga0116171_102650222 | 3300009692 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK* |
| Ga0116141_103083362 | 3300009693 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGIVIGQCLQYHQINILEIIKKLFTK* |
| Ga0116170_104688573 | 3300009694 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGVVVGQLLQYHKRSIENFI |
| Ga0116160_12351033 | 3300009715 | Anaerobic Digestor Sludge | GRMKALTDIALVALGLVVGVVVGQLLQYHQINIQNIIKKIFKKK* |
| Ga0116159_12733303 | 3300009720 | Anaerobic Digestor Sludge | GLVALGLVAGVVIGQLLQYNQINIQNIIKKIFKKK* |
| Ga0116161_11942284 | 3300009767 | Anaerobic Digestor Sludge | MKELTDIGLVALGLVVGVVVGQLLQYNQINIQNIIKKIFKKK* |
| Ga0116161_12400021 | 3300009767 | Anaerobic Digestor Sludge | MKTLTDIALVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK* |
| Ga0116162_102405672 | 3300009772 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGVVVGQLLQYNKHRIEDFINKLKKK* |
| Ga0116152_105422602 | 3300009779 | Anaerobic Digestor Sludge | MKHLTDIGLVALGLVAGVVVGQLLQYHQKRIEEFINKIFKKK* |
| Ga0116178_104881721 | 3300009781 | Anaerobic Digestor Sludge | MKHLTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK* |
| Ga0116157_103576372 | 3300009782 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVVGQLLQYNKHRIENFINKLKKK* |
| Ga0116235_13071092 | 3300010310 | Anaerobic Biogas Reactor | MKPVTAIWLVALGLVVGIVIGQCLQYNKKRIENFTNKLKKK* |
| Ga0116243_100288963 | 3300010344 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK* |
| Ga0116253_101800013 | 3300010345 | Anaerobic Digestor Sludge | MKTLTAFMWVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK* |
| Ga0116239_100808133 | 3300010346 | Anaerobic Digestor Sludge | MKELTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK* |
| Ga0116239_102951222 | 3300010346 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNQKRIEEFVNKIFKKKIK* |
| Ga0116239_104160192 | 3300010346 | Anaerobic Digestor Sludge | AYFKAMKPVTVIWLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK* |
| Ga0116240_100244654 | 3300010349 | Anaerobic Digestor Sludge | MRALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK* |
| Ga0116240_106494573 | 3300010349 | Anaerobic Digestor Sludge | PVTAIWLVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK* |
| Ga0116240_106558733 | 3300010349 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK* |
| Ga0116244_104230884 | 3300010350 | Anaerobic Digestor Sludge | MKALTDIGLVAFGLVVGVVVGQLLQYHQINIMEIIKKIFKK* |
| Ga0116248_102345803 | 3300010351 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVAGVVIGQCLQYNKQRIENFINKLKKK* |
| Ga0116248_108285651 | 3300010351 | Anaerobic Digestor Sludge | VALGLVVGIVIGQCLQYNKQRIENFINKLKKKNNE* |
| Ga0116248_110607283 | 3300010351 | Anaerobic Digestor Sludge | PVTAIWLVALGLVVGVVVGQLLQYHQKRIEEFVNKIFKKKIK* |
| Ga0116237_100220702 | 3300010356 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK* |
| Ga0154020_104242024 | 3300012956 | Active Sludge | MKAFTDIGLVALGLVVGVVLGQLLQYHQKRIEEFINKIFKKK* |
| Ga0172378_113305122 | 3300014203 | Groundwater | MKALTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR* |
| Ga0172381_112804281 | 3300014204 | Landfill Leachate | MKAFTDIALVALGLVAGVVVGKLLQYNKKRIENFINKLKKK* |
| Ga0172381_113965232 | 3300014204 | Landfill Leachate | TAIWLVALGLVAGVVIGQLLQYHQINLLETIKKIFKR* |
| Ga0172380_109457193 | 3300014205 | Landfill Leachate | MKHLTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKL |
| Ga0172380_109837792 | 3300014205 | Landfill Leachate | MKPVTAIWLVALGLVAGVVVGQLLQYNKKRIENFINKLKKK* |
| Ga0172377_106749562 | 3300014206 | Landfill Leachate | MKALTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK* |
| Ga0172382_111099722 | 3300015214 | Landfill Leachate | MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFVNKIFKKKIR* |
| Ga0179946_11745163 | 3300019217 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK |
| Ga0179942_12134862 | 3300019219 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKR |
| Ga0179936_10355102 | 3300019220 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK |
| Ga0180029_10138912 | 3300019224 | Anaerobic Biogas Reactor | MKPVTAIWLVALGLVAGVVVGQLLQYHQINLLETIKKIFKR |
| Ga0180029_10458282 | 3300019224 | Anaerobic Biogas Reactor | MKTLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKNIFKR |
| Ga0179934_11068252 | 3300019226 | Anaerobic Digestor Sludge | MKALTDIGLVAFGLVVGVVVGQLLQYNKHRIENFINKLKKKYYERI |
| Ga0179934_11522551 | 3300019226 | Anaerobic Digestor Sludge | MKELTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK |
| Ga0179935_12780281 | 3300019231 | Anaerobic Digestor Sludge | MKHLTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK |
| Ga0180028_13663612 | 3300019237 | Anaerobic Biogas Reactor | MKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR |
| Ga0180030_10623035 | 3300019239 | Anaerobic Biogas Reactor | MKELTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR |
| Ga0180030_11542062 | 3300019239 | Anaerobic Biogas Reactor | MKALTDIGLVALGLVVGVVVGQLLHHFKPFLDKIFKNKHLTKI |
| Ga0209408_10795874 | 3300025611 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK |
| Ga0209719_10421906 | 3300025677 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVAGVVIGQLLQYNQINIQNIIKKIFGK |
| Ga0209203_11547001 | 3300025702 | Anaerobic Digestor Sludge | CFKTMRALTDIGLVALGLVVGVVIGQLLHYHQINLLETIKKIFKR |
| Ga0209201_11058252 | 3300025708 | Anaerobic Digestor Sludge | MKELTDIGLVALGLVVGIVIGQCLQYNKQRIDNFINKLKKK |
| Ga0208196_11572213 | 3300025724 | Anaerobic Digestor Sludge | MKELTDIALVALGLVAGVVIGQLLQYHQINIQNIIKKIFGK |
| Ga0208694_12200372 | 3300025737 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI |
| Ga0208940_12490372 | 3300025740 | Anaerobic Digestor Sludge | MKTLTAFMWVALGLVVGVVVGQLLQYHQINIQNIIKKIFGK |
| Ga0208459_11770482 | 3300025748 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVAGVVIGQCLQYNKQRIENFINKLKKK |
| Ga0208040_12316071 | 3300025762 | Anaerobic Digestor Sludge | DIALVALGLVVGIPVGACLQYNKHRIENFINKLKKK |
| Ga0209607_10860424 | 3300025847 | Anaerobic Digestor Sludge | MKELTDIALVALGLVVGVVVGQLLQYHQINIMEIIKKIFKK |
| Ga0209604_13764342 | 3300025856 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGIVIGQCLQYHQINILEIIKKLFTK |
| Ga0209099_10773221 | 3300025858 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK |
| Ga0209099_11784371 | 3300025858 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGVVLGQLLQYHQINIQNIIKKIFKKK |
| Ga0209096_10651861 | 3300025859 | Anaerobic Digestor Sludge | MKALTDIGLVALGLVVGVVIGQLLQYNKHRIENFINKLKKKIK |
| Ga0208822_12027903 | 3300025866 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGIVIGQCLQYHQKRIEEFVNKIFKKK |
| Ga0209098_12335162 | 3300025867 | Anaerobic Digestor Sludge | MKTLTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK |
| Ga0208460_101685802 | 3300025877 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGVVVGQLLQYNQKRIEEFINKIFKKKI |
| Ga0209097_102667243 | 3300025882 | Anaerobic Digestor Sludge | MKPVTAIWLVALGLVVGVVVGQLLQYNKKRIENFINKLKKK |
| Ga0209510_12586311 | 3300026290 | Anaerobic Biogas Reactor | KTMKHLTDIGLVAFGLVVGVVLGQLLHYHQINLLETIKKIFKR |
| Ga0209723_10251796 | 3300026311 | Anaerobic Biogas Reactor | MKALTDIGLVALGLVVGIVIGQCLQYNKQRIENFINKLKKK |
| (restricted) Ga0255344_10398392 | 3300028564 | Wastewater | MKPVTAIWLVALGLVVGIVIGQLLQYNKQRIENFINKLKKK |
| (restricted) Ga0255344_11508821 | 3300028564 | Wastewater | MKALTDIGLVAFGLVVGVVLGQLLQYNRHRIENFINKLKKKNNE |
| (restricted) Ga0255341_12997942 | 3300028570 | Wastewater | MKSVTAIWLVALGLVVGVVVGQLLQYNKHRIENFINKLKKKNNE |
| Ga0265294_104828491 | 3300028602 | Groundwater | MKALTDIGLVALGLVVGIVIGQCLQYNKKRIENFINKLKKK |
| Ga0265294_105527583 | 3300028602 | Groundwater | MKPVTAIWLVALGLVAGVVIGQLLQYHQINLLETIKNIFKR |
| Ga0265294_106058302 | 3300028602 | Groundwater | MKHLTDIGLVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI |
| Ga0265293_105444463 | 3300028603 | Landfill Leachate | LVALGLVVGVVIGQLLQYHQKRIEEFINKIFKKKI |
| (restricted) Ga0255346_10674334 | 3300028677 | Wastewater | MKPVTAIWLVALGLVVGVVVGQLLQYNKQRIENFINKLKKK |
| Ga0265297_108828932 | 3300029288 | Landfill Leachate | MKHLTDIGLVALGLVVGVVVGQLLQYHQKRIEEFINKIFKKKI |
| Ga0334900_10057251 | 3300033166 | Sludge | MKELTDIGLVAFGLVVGVVLGQLLHYHQINLLETIK |
| ⦗Top⦘ |