NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247611_10000085

Scaffold Ga0247611_10000085


Overview

Basic Information
Taxon OID3300028591 Open in IMG/M
Scaffold IDGa0247611_10000085 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1770 DNA GHGhigh gp2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)176443
Total Scaffold Genes359 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)110 (30.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameNew Zealand: Palmerston North, Manawatu-Wanganui
CoordinatesLat. (o)-40.3794Long. (o)175.6106Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057035Metagenome / Metatranscriptome136Y
F075545Metagenome / Metatranscriptome118Y
F079361Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0247611_1000008522F057035N/AMTEKEFLEKRIPIWLEGEDLHIATPSNMDKNDMHAFLSKKYGYSWLFAIRGYYWPGSHVTLYIGDYECPNCTTLVAPYLFNYFPDIKYVGFGCNKGAVGEIWPAKILIVRDKSYLKDDIGSI
Ga0247611_1000008526F079361N/AMIYFTIAKNDCGYLIDSISTDLEKLKYKFPDEIIYQSDEPIVSIYVIKDQLNEI
Ga0247611_1000008530F075545N/AMIQLVVNTDLLREIDERKLINAYARHIYNDEEDTSDDVRIRENLKQLLDWDENGDNGLGIYCSKFENLKNKDWIKLINFIKENHHEIKSISYSSVKERKLESIKVINSAIEAKEKYNNDRFTAEDYKVSGRGKKARPCIYEGREYKSRQECMYKEGLTKYQIWKYLKNTNQI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.