Scaffold Ga0247828_10270816

Overview

Basic Information

• Taxon OID: 3300028587
• Scaffold ID: Ga0247828_10270816
• Source Dataset Name: Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 923
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.673
  • Long. (^o): -77.032
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095275	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247828_102708161	F095275	N/A	VDLTEAERAAFVNHDMRRINELGGYLHLVMSVPGLAAH