Scaffold Ga0265797_10271114

Overview

Basic Information

• Taxon OID: 3300028585
• Scaffold ID: Ga0265797_10271114
• Source Dataset Name: Plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T30
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1193
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.7416
  • Long. (^o): -117.7042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056350	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265797_102711141	F056350	N/A	LAWYQRTYFNLNIGNLIKYFSILTVAFHDIHSLFGFCILLVVFSQLVSGTMLSFSLVPESMMVPIVRDEEDLEDLYTDDFFXIHERGVDLLFIFSXLHLCRKLYINAF