Scaffold Ga0265797_10015411

Overview

Basic Information

• Taxon OID: 3300028585
• Scaffold ID: Ga0265797_10015411
• Source Dataset Name: Plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T30
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8899
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria → Alternaria alternata complex → Alternaria alternata (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.7416
  • Long. (^o): -117.7042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102612	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0265797_100154113	F102612	N/A	MSSPAQPSPEVLQAYHQRLETLYQSLPDLLTTEQEDKTGTEALEQDVGKLDVKEQNLEDRVNKYCQEFLYIGGPTPYKRDLTST