| Basic Information | |
|---|---|
| Taxon OID | 3300028582 Open in IMG/M |
| Scaffold ID | Ga0268360_1016454 Open in IMG/M |
| Source Dataset Name | Sewage microbial communities from Oakland, California, United States - Biofuel 11 (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1841 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanospirillaceae → Methanospirillum → Methanospirillum lacunae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Sewage → Sewage Microbial Communities From Oakland, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.82 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083634 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268360_10164543 | F083634 | GGA | MYIMLKMADQTISLDRIKINGRVCRLARKLIVTVEHENDRLTLSNKEFGLVVSAETLEEGITGLSEELASLWEVYVDADPANLTADALRLRSNLTSLVPA |
| ⦗Top⦘ |