Scaffold Ga0268357_105787

Overview

Basic Information

• Taxon OID: 3300028580
• Scaffold ID: Ga0268357_105787
• Source Dataset Name: Sewage microbial communities from Oakland, California, United States - Biofuel 10 (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3505
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Sewage → Sewage Microbial Communities From Oakland, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.82
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025048	Metagenome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268357_1057876	F025048	AGG	MLNPTLITDAIASVLLSIPELYAAMGGRITAFHYRLGQEHRLAEAIYKMPAPSMLIVWEGTKGGSFDGQTIWKHRWGVYYRMGNAAGVAEPVGYEDLWWITCNCPPGGSGPNIRYLQLYPGLDIMDTPSIDHELDEDLIDRFKGLFIIPEIGDN