Basic Information | |
---|---|
Taxon OID | 3300028580 Open in IMG/M |
Scaffold ID | Ga0268357_105787 Open in IMG/M |
Source Dataset Name | Sewage microbial communities from Oakland, California, United States - Biofuel 10 (Illumina Assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3505 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Sewage → Sewage Microbial Communities From Oakland, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.82 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025048 | Metagenome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268357_1057876 | F025048 | AGG | MLNPTLITDAIASVLLSIPELYAAMGGRITAFHYRLGQEHRLAEAIYKMPAPSMLIVWEGTKGGSFDGQTIWKHRWGVYYRMGNAAGVAEPVGYEDLWWITCNCPPGGSGPNIRYLQLYPGLDIMDTPSIDHELDEDLIDRFKGLFIIPEIGDN |
⦗Top⦘ |