NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213905_102235

Scaffold Ga0213905_102235


Overview

Basic Information
Taxon OID3300028551 Open in IMG/M
Scaffold IDGa0213905_102235 Open in IMG/M
Source Dataset NameSwitchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Shaw_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)828
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)38.083Long. (o)-81.98Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073080Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0213905_1022352F073080GGCGGMNERQQAHVVYYLQRLEYRQGHKPSGSTPRLMAAGDADETHPLRSEEEATEVVEHLWRLERGNADEEGCEAEQI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.