Scaffold Ga0307877_118654

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307877_118654

Scaffold Ga0307877_118654

Overview

Basic Information
Taxon OID	3300028543 Open in IMG/M
Scaffold ID	Ga0307877_118654 Open in IMG/M
Source Dataset Name	Lab enriched biofilm microbial communities from the Montreal Biodome aquarium denitrification system, Montreal, Canada - optimal
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Genome Quebec
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	700
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Lab Enriched Biofilm Microbial Communities From The Montreal Biodome Aquarium Denitrification System, Montreal, Canada

Source Dataset Sampling Location
Location Name	Montreal, Canada
Coordinates	Lat. (^o)	45.5596	Long. (^o)	-73.5497	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078533	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307877_1186541	F078533	GAGG	MTPDQFKQARQTLGLSQRDLAAEWGMGANGERTIRRWETGVVPVNPIAAYCIALMLGSRQARDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.