3300028543: Lab enriched biofilm microbial communities from the Montreal Biodome aquarium denitrification system, Montreal, Canada - optimal

Overview

Basic Information

• IMG/M Taxon OID: 3300028543
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0135158 | Gp0322558 | Ga0307877
• Sample Name: Lab enriched biofilm microbial communities from the Montreal Biodome aquarium denitrification system, Montreal, Canada - optimal
• Sequencing Status: Permanent Draft
• Sequencing Center: Genome Quebec
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 35158856
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Lab Enriched Biofilm Microbial Communities From The Montreal Biodome Aquarium Denitrification System, Montreal, Canada
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Lab Enriched Biofilm Microbial Communities From The Montreal Biodome Aquarium Denitrification System, Montreal, Canada

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Montreal, Canada
• Coordinates
  • Lat. (^o): 45.5596
  • Long. (^o): -73.5497
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078533	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0307877_118654	All Organisms → cellular organisms → Bacteria → Proteobacteria	700

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0307877_118654	Ga0307877_1186541	F078533	MTPDQFKQARQTLGLSQRDLAAEWGMGANGERTIRRWETGVVPVNPIAAYCIALMLGSRQARDA