| Basic Information | |
|---|---|
| Taxon OID | 3300028533 Open in IMG/M |
| Scaffold ID | Ga0233386_1035126 Open in IMG/M |
| Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1026 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074226 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233386_10351261 | F074226 | N/A | MVELTRDRKTRHMWLITTTDSEGFHRQLPISHDDMTDLMRQWIEETI |
| ⦗Top⦘ |