Scaffold Ga0233386_1003907

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0233386_1003907

Scaffold Ga0233386_1003907

Overview

Basic Information
Taxon OID	3300028533 Open in IMG/M
Scaffold ID	Ga0233386_1003907 Open in IMG/M
Source Dataset Name	Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3125
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	38.04	Long. (^o)	-122.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072921	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233386_10039071	F072921	N/A	MKSRLSLSTDRKSAAESEYIEIRWACDACPDSLFLSIDSGCTQYSIAVSDSGVTRIPIPRSNGKMTVKLIGVISGKKVTESIDVRVKATKKAGTKAPLSSRMKMFGEKMQAKWYVFRANIKYWWLSQKKWQKALWIALLALWLGLLFS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.