Scaffold Ga0256824_10228558

Overview

Basic Information

• Taxon OID: 3300028490
• Scaffold ID: Ga0256824_10228558
• Source Dataset Name: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV67
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 639
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8597
  • Long. (^o): -104.2997
  • Depth (m): 2507

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026277	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256824_102285582	F026277	N/A	ENTKPIWEQLNDTSKKSILSQARLYPEDVLTTEAQVEHFWSTRKLKTNESVTKKLVSHESLIQEDKLSNNEVQAIMERFKNI