3300028490: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV67

Overview

Basic Information

• IMG/M Taxon OID: 3300028490
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046784 | Gp0296289 | Ga0256824
• Sample Name: Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV67
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 611481128
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Pacific Ocean: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8597
  • Long. (^o): -104.2997
  • Alt. (m): N/A
  • Depth (m): 2507

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026277	Metagenome / Metatranscriptome	198	Y
F031102	Metagenome / Metatranscriptome	183	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0256824_10228558	All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage	639

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0256824_10228558	Ga0256824_102285582	F026277	ENTKPIWEQLNDTSKKSILSQARLYPEDVLTTEAQVEHFWSTRKLKTNESVTKKLVSHESLIQEDKLSNNEVQAIMERFKNI
Ga0256824_10298972	Ga0256824_102989722	F031102	MSEGRYSMKEVLKQKFGEAEKNTKTSMSTKRVKSKSKGKYIVKIVNGVKYMTLR