NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233383_1034650

Scaffold Ga0233383_1034650


Overview

Basic Information
Taxon OID3300028480 Open in IMG/M
Scaffold IDGa0233383_1034650 Open in IMG/M
Source Dataset NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G16
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)833
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104183Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0233383_10346501F104183N/AAIFQCIKQIIAIMTQQDFQQKAKKAAKEFANKKKVASQPETQFVKGALWAWELLTQGRAVADYEEQLRRDVCARFGIDQPEQWQELLISETATMMADRDGMQQDILTEGRLLEKFDKNMNPYKESNPLYVHLKELQRSIGMQREHLGLTNKSSKKMESPKTHDVKDDPLGEYFEGIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.