Scaffold Ga0233383_1017599

Overview

Basic Information

• Taxon OID: 3300028480
• Scaffold ID: Ga0233383_1017599
• Source Dataset Name: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung G16
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1329
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.04
  • Long. (^o): -122.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072921	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233383_10175991	F072921	N/A	MKKKMKLSTDRKSASEGEYIEIRWACDACPDSLYLAIDSERTQYSIAVSDSGTTRIPVPMSNGKMTVKLIGIISGKKVTESVDVRVKGAKRAKSNAPLSSRMKMFGEKMKAKWYVFRAQMKYWWLSQKKWQKALWIALLALWFGLLFSSIGRKPEVKVSSD