Scaffold Ga0307245_1724720

Overview

Basic Information

• Taxon OID: 3300028454
• Scaffold ID: Ga0307245_1724720
• Source Dataset Name: Goat Fecal Pellet Co-assembly of all samples untreated with antibiotics
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3088
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4148
  • Long. (^o): -119.8405
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041506	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307245_17247206	F041506	N/A	MSKTYTLEDGESLMAELKSTRGMMAEMRGRLERDEITPDEWREWYAGYQARLDEIKEAVSGMREDVSRRNADLERQKRERAAELNMSLEEYETYLKSLIIR