Scaffold Ga0268263_1029796

Overview

Basic Information

• Taxon OID: 3300028326
• Scaffold ID: Ga0268263_1029796
• Source Dataset Name: Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 5 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1141
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location

• Location Name: Lawrence Berkeley National Laboratory, California, USA
• Coordinates
  • Lat. (^o): 37.8754404
  • Long. (^o): -122.2477251

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014318	Metagenome / Metatranscriptome	264	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268263_10297961	F014318	N/A	MGHTGESMSDLYDKIKEDVAFRKQWAEKCGFGFELPSIVPNVPKTRAKSKSMKAA