NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257107_1057381

Scaffold Ga0257107_1057381


Overview

Basic Information
Taxon OID3300028192 Open in IMG/M
Scaffold IDGa0257107_1057381 Open in IMG/M
Source Dataset NameMarine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1195
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: Northeast Subartic Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012279Metagenome / Metatranscriptome282Y
F072760Metagenome121N

Sequences

Protein IDFamilyRBSSequence
Ga0257107_10573811F012279N/AMTERENVEGMLIENRLSELRDTVRTLETVETTLESLRETKWTLVSELRELGHDFKATAEGMDIVLSSSPSMNWK
Ga0257107_10573813F072760N/AMELHTLRAVKITKNIFELHRVNTELQHLKICVKVLENRKIELENSF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.