Scaffold Ga0256900_1090719

Overview

Basic Information

• Taxon OID: 3300028160
• Scaffold ID: Ga0256900_1090719
• Source Dataset Name: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0688-MT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 581
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Peloderinae → Caenorhabditis → Caenorhabditis elegans (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): -93.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015430	Metagenome / Metatranscriptome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256900_10907191	F015430	N/A	MFSALILAATLALALADTPCTPEQTKIYWKAPCDGQTFENKIVPLNVTVMQDGKLVDDRGGLDLEIAINIVSEIKNNYGQTTKPLVDLAIYEYSKPLFGGDCSWKALPTFGLLSNLDACTMIENCHMTGLPTTLKASVDVKTIAGPLLHLVTKDAYYGLTLTFKDDKTPTVCVYIQDRV