NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256371_112526

Scaffold Ga0256371_112526


Overview

Basic Information
Taxon OID3300028122 Open in IMG/M
Scaffold IDGa0256371_112526 Open in IMG/M
Source Dataset NameSea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SI3M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)789
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.3731Long. (o)-156.5049Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033250Metagenome178N

Sequences

Protein IDFamilyRBSSequence
Ga0256371_1125262F033250GGAGMDVKLTTTRQLSPVFDEGGQIDLEALRPLLEQHAATMVSDAQSGWPVDTGISRAAWTAEIDVSPSQLFVSLINEARQRGRGYAVYIHRARSPRLVYTEVEERFTLNLIPALQADIALTLAESMRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.