Scaffold Ga0255184_1030566

Overview

Basic Information

• Taxon OID: 3300028091
• Scaffold ID: Ga0255184_1030566
• Source Dataset Name: Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1122
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location

• Location Name: USA: Louisiana
• Coordinates
  • Lat. (^o): 29.8571
  • Long. (^o): -89.9778
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093799	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255184_10305664	F093799	N/A	ETPTRRMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS