Scaffold Ga0255216_1053075

Overview

Basic Information

• Taxon OID: 3300028071
• Scaffold ID: Ga0255216_1053075
• Source Dataset Name: Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8d
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 566
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location

• Location Name: USA: Louisiana
• Coordinates
  • Lat. (^o): 29.8571
  • Long. (^o): -89.9778
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061856	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255216_10530751	F061856	N/A	KMDATFNLTRTKVKTMNQHQNQVSRAMIHINDVKYDLLKIAELYDGVLQEGLGHMPADMFNAYLSDLRGEDWVHDFEVSEITLKEQSYTYDISVQITKDRTPKKLKIHVGLYKSPWPELAVSKMKYTGNGYVTK