Scaffold Ga0265296_1004128

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265296_1004128

Scaffold Ga0265296_1004128

Overview

Basic Information
Taxon OID	3300028032 Open in IMG/M
Scaffold ID	Ga0265296_1004128 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12829
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (68.75%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Waterloo, Ontario
Coordinates	Lat. (^o)	43.442	Long. (^o)	-80.577	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058941	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265296_10041286	F058941	N/A	MSRRTLTAIGLGLLIAALTLFVSRRFGITFLFLPLFFTWGRGRRDGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.