| Basic Information | |
|---|---|
| Taxon OID | 3300028026 Open in IMG/M |
| Scaffold ID | Ga0256846_1147089 Open in IMG/M |
| Source Dataset Name | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Tevnia |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8441 | Long. (o) | -104.2969 | Alt. (m) | Depth (m) | 2511 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256846_11470891 | F025922 | AGGAGG | MARNRIIYASQSVWINGEVLYRVQSLGTTTTFTSEDIFELGHLDIVDVVDDVPAVAVTLNTNDFGDVKTLAVLAQVAPAKIDMDASATSVNANLVAGGSTYLHGVALADFAVTCGNLTGVTLWAPVQDECSLGTLANNIDQSLYLDEVYINSLEFSYTTGANATENYG |
| ⦗Top⦘ |