Scaffold Ga0255336_102671

Overview

Basic Information

• Taxon OID: 3300028024
• Scaffold ID: Ga0255336_102671
• Source Dataset Name: Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T3_179
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 8430
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Vancouver, British Columbia
• Coordinates
  • Lat. (^o): 49.2598372
  • Long. (^o): -123.2459363
  • Depth (m): .35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007854	Metagenome / Metatranscriptome	343	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255336_1026718	F007854	GGAG	MNTIIANQYGRVQGEVAGNCGLTFAVAAETPRRESVKLQTRIDSVEQQLHLLAILRAVECRIEQFQLRDAKTPQSAEQESPFDDTICTEGDLFGSNGSSSKNKIYGRFAQFLVYEQVDQGRLRVFFAVRDDAKRVARFDLHPGEVQAMQALARRALYASEQIDLLLRDDLSLSVALNVSGHGLRFDVQTPLWRSQFAVCKANDMATLAVFTRRAVNQEKAVPIRFGDEANQFGLRKRNDGQVVAEFQHQDAAERVPVSTLQLYELEALAQYALHRAFEPAANVAIEGHLQPKTEASAQIA