 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300028024 Open in IMG/M |
| Scaffold ID | Ga0255336_100463 Open in IMG/M |
| Source Dataset Name | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T3_179 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 63432 |
| Total Scaffold Genes | 54 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 41 (75.93%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Vancouver, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.2598372 | Long. (o) | -123.2459363 | Alt. (m) | Depth (m) | .35 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033667 | Metagenome / Metatranscriptome | 176 | Y |
| F080760 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255336_10046331 | F080760 | N/A | MTTKTLATTAAVPEGQKLSVLEPQRGACVEFVKFCKEQHLSSRAAHTFLRVLHNKTWDAECDKIRDSMRPEVDRIFEPAEKALNEGANCKEVLAVLVESLKKAEEL |
| Ga0255336_10046341 | F033667 | GGAGG | MILLVTSSNRRMECGAALEIVIGESVEVCETVRKAASMLRNNEYSAVVMDEPMVEADGDALESLLNNIGLAVPVYVNLAVSNADRVARELRLALRRNRESRMIAVRAAESQLRSEIRDAITGILLSAELAMRTPEIPADAIEKLTSVCQLASSVRSRLESVN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |