Scaffold Ga0265344_101072

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265344_101072

Scaffold Ga0265344_101072

Overview

Basic Information
Taxon OID	3300028011 Open in IMG/M
Scaffold ID	Ga0265344_101072 Open in IMG/M
Source Dataset Name	Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	767
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Norway: Oslo
Coordinates	Lat. (^o)	59.9979	Long. (^o)	10.7895	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002220	Metagenome	581	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265344_1010721	F002220	N/A	RKAIESLFRERIYLLKSNSIIKLSFSFSFTIRFAFTSSSSLRAKNWLSPKIIILLVYMPTILNRVPIVIIRKYRLNIEVVIKSFSL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.