Scaffold Ga0209166_10032922

Overview

Basic Information

• Taxon OID: 3300027857
• Scaffold ID: Ga0209166_10032922
• Source Dataset Name: Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3140
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania, Centralia
• Coordinates
  • Lat. (^o): 40.7999
  • Long. (^o): -76.3402

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078985	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209166_100329223	F078985	GAG	MAAKKIEEIERAIGTLTQEELEELRVWLDEYAGPRPLDLRIETDLAEGRLDTAVDRALDDETHSRTRPL