Scaffold Ga0209345_10543983

Overview

Basic Information

• Taxon OID: 3300027852
• Scaffold ID: Ga0209345_10543983
• Source Dataset Name: Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 659
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location

• Location Name: Coal Oil Point, Santa Barbara, CA
• Coordinates
  • Lat. (^o): 34.39225
  • Long. (^o): -119.845662

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073571	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209345_105439831	F073571	N/A	MVFSRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLD