NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209230_10168928

Scaffold Ga0209230_10168928


Overview

Basic Information
Taxon OID3300027836 Open in IMG/M
Scaffold IDGa0209230_10168928 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1251
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameCanada: Lake Ontario
CoordinatesLat. (o)43.933506Long. (o)-78.003845Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023346Metagenome / Metatranscriptome210Y
F039627Metagenome / Metatranscriptome163N
F045085Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0209230_101689281F039627N/AMTASFYKTVYQRKFKEMPRWKQLAIVEDSTRNNWSGLLTDFVKAVIEEAEKEYANSKSTVSNPPNKYVSETDNKVKKTIKKKS
Ga0209230_101689283F023346N/AMKHTPNIVSKNIIITYAQKIRNVQSEQIDPYIELIEQELIKIYPELKDREDNALNWAYDIINETSNNDVVETLNRLDGIVTNERKSQWICDHCGKNTYNDDCEYLFGKNHIGCVLSEDIKNREHSDPDYILDSNLRKFTELEAELRHTKRQLVNLELKLERLRGDYPHEPTN
Ga0209230_101689284F045085N/AIFCSIFAIGIVLVITIFFAVLIPFIFYFTVKEVLKALTKTK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.