Scaffold Ga0209797_10148658

Overview

Basic Information

• Taxon OID: 3300027831
• Scaffold ID: Ga0209797_10148658
• Source Dataset Name: Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1008
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location

• Location Name: USA: Michigan, St. Louis River estuary
• Coordinates
  • Lat. (^o): 46.6972164
  • Long. (^o): -92.3279105

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096818	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209797_101486581	F096818	N/A	YPTSWPPFGVTDPRTWGPNKAIYWAKIGFEKWWLWRYF