Scaffold Ga0209990_10066487

Overview

Basic Information

• Taxon OID: 3300027816
• Scaffold ID: Ga0209990_10066487
• Source Dataset Name: Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1801
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie
• Coordinates
  • Lat. (^o): 41.69957
  • Long. (^o): -83.2941

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097457	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209990_100664871	F097457	N/A	KKTYQKPEYSGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYETTELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ