NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097457

Metagenome / Metatranscriptome Family F097457

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097457
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 149 residues
Representative Sequence MTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Number of Associated Samples 95
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.85 %
% of genes near scaffold ends (potentially truncated) 42.31 %
% of genes from short scaffolds (< 2000 bps) 66.35 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.692 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(13.462 % of family members)
Environment Ontology (ENVO) Unclassified
(54.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(62.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.26%    β-sheet: 15.58%    Coil/Unstructured: 44.16%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01832Glucosaminidase 15.38
PF12705PDDEXK_1 0.96
PF07460NUMOD3 0.96
PF07453NUMOD1 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.23 %
UnclassifiedrootN/A5.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10163548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium629Open in IMG/M
3300001843|RCM34_1074351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium744Open in IMG/M
3300002304|B570J29606_1002598All Organisms → Viruses → Predicted Viral2022Open in IMG/M
3300002372|B570J29634_100118All Organisms → Viruses → Predicted Viral3494Open in IMG/M
3300002393|B570J29605_1010174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium554Open in IMG/M
3300002408|B570J29032_108940309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium546Open in IMG/M
3300002835|B570J40625_100002950Not Available31890Open in IMG/M
3300002835|B570J40625_100559040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1058Open in IMG/M
3300003393|JGI25909J50240_1031727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1157Open in IMG/M
3300003499|JGI25930J51415_1016323All Organisms → Viruses → Predicted Viral1433Open in IMG/M
3300005527|Ga0068876_10017734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium4529Open in IMG/M
3300005584|Ga0049082_10007597All Organisms → cellular organisms → Bacteria3634Open in IMG/M
3300005758|Ga0078117_1000223Not Available112048Open in IMG/M
3300006030|Ga0075470_10032372All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300006355|Ga0075501_1260016All Organisms → Viruses → Predicted Viral3583Open in IMG/M
3300007545|Ga0102873_1128141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium765Open in IMG/M
3300007549|Ga0102879_1022970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2070Open in IMG/M
3300007550|Ga0102880_1210781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium507Open in IMG/M
3300007551|Ga0102881_1068279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium991Open in IMG/M
3300007562|Ga0102915_1009632All Organisms → Viruses → Predicted Viral3223Open in IMG/M
3300007585|Ga0102916_1121182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium703Open in IMG/M
3300007603|Ga0102921_1207034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium705Open in IMG/M
3300007625|Ga0102870_1130254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium727Open in IMG/M
3300008021|Ga0102922_1189200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium648Open in IMG/M
3300008052|Ga0102893_1212842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium557Open in IMG/M
3300008119|Ga0114354_1012575All Organisms → cellular organisms → Bacteria3896Open in IMG/M
3300008259|Ga0114841_1109415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1180Open in IMG/M
3300008266|Ga0114363_1001783Not Available13511Open in IMG/M
3300008448|Ga0114876_1166815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium784Open in IMG/M
3300008450|Ga0114880_1013322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3990Open in IMG/M
3300008450|Ga0114880_1055267All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300009049|Ga0102911_1073530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium988Open in IMG/M
3300009068|Ga0114973_10004353All Organisms → cellular organisms → Bacteria9835Open in IMG/M
3300009152|Ga0114980_10749702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium545Open in IMG/M
3300009159|Ga0114978_10303996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium976Open in IMG/M
3300009159|Ga0114978_10303997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium976Open in IMG/M
3300009165|Ga0105102_10030509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2258Open in IMG/M
3300010354|Ga0129333_10413488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1192Open in IMG/M
3300010354|Ga0129333_10549257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1007Open in IMG/M
3300011010|Ga0139557_1017604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1333Open in IMG/M
3300011268|Ga0151620_1014621All Organisms → Viruses → Predicted Viral2773Open in IMG/M
3300012012|Ga0153799_1039647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium884Open in IMG/M
3300012663|Ga0157203_1001344All Organisms → cellular organisms → Bacteria6054Open in IMG/M
3300012666|Ga0157498_1049007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium647Open in IMG/M
3300013004|Ga0164293_10211326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1394Open in IMG/M
3300013004|Ga0164293_10359156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium992Open in IMG/M
3300013005|Ga0164292_10385822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium938Open in IMG/M
3300013372|Ga0177922_10009427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium616Open in IMG/M
3300013372|Ga0177922_10119161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1133Open in IMG/M
3300017747|Ga0181352_1089079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium855Open in IMG/M
3300017754|Ga0181344_1026826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1768Open in IMG/M
3300019781|Ga0181360_107659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium911Open in IMG/M
3300019784|Ga0181359_1002226All Organisms → cellular organisms → Bacteria5559Open in IMG/M
3300020160|Ga0211733_10179053All Organisms → cellular organisms → Bacteria3060Open in IMG/M
3300020160|Ga0211733_10490367All Organisms → Viruses → Predicted Viral1093Open in IMG/M
3300020161|Ga0211726_11028176All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300020172|Ga0211729_10689063All Organisms → Viruses → Predicted Viral1232Open in IMG/M
3300020488|Ga0208051_100467All Organisms → cellular organisms → Bacteria5286Open in IMG/M
3300020494|Ga0208326_102852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1580Open in IMG/M
3300020510|Ga0208086_1016612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1041Open in IMG/M
3300020526|Ga0208085_1021509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium896Open in IMG/M
3300020534|Ga0208596_1001853All Organisms → cellular organisms → Bacteria5268Open in IMG/M
3300020550|Ga0208600_1021572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1027Open in IMG/M
3300020564|Ga0208719_1064690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium641Open in IMG/M
3300021602|Ga0194060_10084511All Organisms → Viruses → Predicted Viral1772Open in IMG/M
3300021961|Ga0222714_10046073All Organisms → cellular organisms → Bacteria3069Open in IMG/M
3300024483|Ga0255224_1046320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium892Open in IMG/M
3300024531|Ga0255228_1013945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1499Open in IMG/M
3300024537|Ga0255225_1046026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium736Open in IMG/M
3300025732|Ga0208784_1000042Not Available55180Open in IMG/M
3300027129|Ga0255067_1049639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium599Open in IMG/M
3300027247|Ga0208679_1051787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium770Open in IMG/M
3300027285|Ga0255131_1007347All Organisms → cellular organisms → Bacteria2693Open in IMG/M
3300027299|Ga0255124_1019447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1326Open in IMG/M
3300027531|Ga0208682_1061211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium949Open in IMG/M
3300027534|Ga0255125_1006127All Organisms → Viruses → Predicted Viral3008Open in IMG/M
3300027578|Ga0255075_1056231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium704Open in IMG/M
3300027586|Ga0208966_1080919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium903Open in IMG/M
3300027693|Ga0209704_1196536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium588Open in IMG/M
3300027732|Ga0209442_1009723All Organisms → cellular organisms → Bacteria4717Open in IMG/M
3300027782|Ga0209500_10020854All Organisms → Viruses → Predicted Viral3820Open in IMG/M
3300027782|Ga0209500_10183330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium958Open in IMG/M
3300027816|Ga0209990_10066487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1801Open in IMG/M
3300027971|Ga0209401_1003591All Organisms → cellular organisms → Bacteria9747Open in IMG/M
3300027973|Ga0209298_10409092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium508Open in IMG/M
3300028257|Ga0255257_1053053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium547Open in IMG/M
3300029697|Ga0256301_1038362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium815Open in IMG/M
3300031758|Ga0315907_10883583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium658Open in IMG/M
3300031787|Ga0315900_10015427Not Available9177Open in IMG/M
3300031857|Ga0315909_10005263Not Available14931Open in IMG/M
3300032092|Ga0315905_10065146All Organisms → cellular organisms → Bacteria3693Open in IMG/M
3300032093|Ga0315902_10720593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium807Open in IMG/M
3300032116|Ga0315903_10176902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1925Open in IMG/M
3300033978|Ga0334977_0017931All Organisms → cellular organisms → Bacteria4042Open in IMG/M
3300033992|Ga0334992_0021563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3983Open in IMG/M
3300033994|Ga0334996_0141668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1348Open in IMG/M
3300034013|Ga0334991_0013410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium5077Open in IMG/M
3300034066|Ga0335019_0258503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1106Open in IMG/M
3300034068|Ga0334990_0028997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2951Open in IMG/M
3300034102|Ga0335029_0474545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium733Open in IMG/M
3300034272|Ga0335049_0399974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium900Open in IMG/M
3300034283|Ga0335007_0315176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1017Open in IMG/M
3300034283|Ga0335007_0748590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium538Open in IMG/M
3300034284|Ga0335013_0606339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium639Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.46%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater10.58%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.62%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.92%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.96%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.96%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.96%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.96%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300002304Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002372Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002393Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020488Freshwater microbial communities from Lake Mendota, WI - 17OCT2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020494Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020510Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020526Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020534Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024531Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024537Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027247Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027285Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027299Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027531Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027534Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028257Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029697Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1016354813300001282FreshwaterMYSGKLSTYQANTNNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
RCM34_107435123300001843Marine PlanktonDQDPFNPNQNFLYKRAIFGITMYTEEELKEMSEAKKQRVIKAHRKTQFILNTWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
B570J29606_100259833300002304FreshwaterMTKENRVMYSGKLSTYQANTKNFXGKSYXVYDKXPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
B570J29634_10011873300002372FreshwaterMTKENRVMYSGKLSTYQANTKNFXGKSYXVYDKXPFXPXQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
B570J29605_101017413300002393FreshwaterQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
B570J29032_10894030923300002408FreshwaterNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
B570J40625_100002950383300002835FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
B570J40625_10055904013300002835FreshwaterMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKVHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
JGI25909J50240_103172713300003393Freshwater LakeMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
JGI25930J51415_101632313300003499Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGIL
Ga0068876_10017734133300005527Freshwater LakeMKKTYQKPEYSGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYETTELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ*
Ga0049082_1000759743300005584Freshwater LenticMTKENKVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0078117_100022323300005758Lake WaterMKKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGISMYTEEEIREMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0075470_1003237243300006030AqueousMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNCLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0075501_126001643300006355AqueousMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMRIKFSNCLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0102873_112814113300007545EstuarineQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102879_102297013300007549EstuarineNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102880_121078113300007550EstuarineANTKNFKGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102881_106827913300007551EstuarineMTKENRVMYSGKLSTYQANTKNFKGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102915_100963253300007562EstuarineMTKENLVMYSGMLSTYQANTKNVNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102916_112118223300007585EstuarineMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLFGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102921_120703413300007603EstuarineTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102870_113025413300007625EstuarineMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0102922_118920023300008021EstuarineMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIID
Ga0102893_121284213300008052EstuarineMTKENRVMYSGKLSTYQANTKNFKGKSYQVYDKDPFNPNKNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLG
Ga0114354_101257553300008119Freshwater, PlanktonMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0114841_110941513300008259Freshwater, PlanktonENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSEAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0114363_100178383300008266Freshwater, PlanktonMKKTYQKPEYSGKISTYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYEPAELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ*
Ga0114876_116681513300008448Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFK
Ga0114880_101332253300008450Freshwater LakeMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSEAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0114880_105526753300008450Freshwater LakeMTKENRVMYSGQLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS*
Ga0102911_107353013300009049EstuarineMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLG
Ga0114973_10004353103300009068Freshwater LakeMKKDNRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0114980_1074970223300009152Freshwater LakeSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0114978_1030399613300009159Freshwater LakeMKKDNRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKD
Ga0114978_1030399713300009159Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKD
Ga0105102_1003050933300009165Freshwater SedimentMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0129333_1041348833300010354Freshwater To Marine Saline GradientMKKTYQKPEYSGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYEPAELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ*
Ga0129333_1054925723300010354Freshwater To Marine Saline GradientMKKENRVMYSGKLSAYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPINFYQIS*
Ga0139557_101760423300011010FreshwaterMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0151620_101462133300011268FreshwaterMKKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPINFYQIS*
Ga0153799_103964723300012012FreshwaterMTKENKVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSEAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLSHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0157203_100134453300012663FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLNMYTEAELTEMSEAKKQRVIKAHRKTQFILNSWKQEMLIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0157498_104900723300012666Freshwater, Surface IceMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLI
Ga0164293_1021132613300013004FreshwaterMTKENRVMYSGKLSTYQANTKNLNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0164293_1035915623300013004FreshwaterMIGGVTAPFYFYHITLIKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0164292_1038582223300013005FreshwaterMIGGVTAPFYFLPHYSNQKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS*
Ga0177922_1000942723300013372FreshwaterLIKKPHMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRRTQFILNSWKQEVVIKFSNSLLSHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0177922_1011916123300013372FreshwaterMTKENKVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSEAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT*
Ga0181352_108907913300017747Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHTFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0181344_102682613300017754Freshwater LakeTKEKRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0181360_10765923300019781Freshwater LakeMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0181359_100222673300019784Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0211733_1017905373300020160FreshwaterMYSGKLSTYQANTNNFKGKSYQVYEKDPFNPNQNFLYKRAMFGITMYTEAELAEMSEAKKQRVIKAHRRTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTETDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIS
Ga0211733_1049036733300020160FreshwaterMTKENRVMYSGKLSTYQANTNNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0211726_1102817623300020161FreshwaterMYSGKLSTYQANTNNFKGKSYQVYEKDPFNPNQNFLYKRAMFGITMYTEAELAEMSEAKKQRVIKAHRRTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTETDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIS
Ga0211729_1068906313300020172FreshwaterKKENRVMYSGKLSTYQANTNNFKGKSYQVYEKDPFNPNQNFLYKRAMFGITMYTEAELAEMSEAKKQRVIKAHRRTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTETDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIS
Ga0208051_100467143300020488FreshwaterMYSGKLSTYQANTNNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0208326_10285223300020494FreshwaterMKKDNRVMYSGKLSTYQANTNNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0208086_101661223300020510FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0208085_102150913300020526FreshwaterMTKENRVMYSGKLSTYQANTKNLNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0208596_100185343300020534FreshwaterMIGGVTAPFYFLPHYSNQKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0208600_102157213300020550FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENAEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0208719_106469023300020564FreshwaterMIGGVTAPFYFLPHYSNQKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLID
Ga0194060_1008451133300021602Anoxic Zone FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNLNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0222714_1004607363300021961Estuarine WaterMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPINFYQIS
Ga0255224_104632013300024483FreshwaterSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0255228_101394523300024531FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0255225_104602623300024537FreshwaterFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0208784_1000042603300025732AqueousMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGISMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNCLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0255067_104963923300027129FreshwaterTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0208679_105178713300027247EstuarineQTKLPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0255131_100734773300027285FreshwaterRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0255124_101944733300027299FreshwaterMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSF
Ga0208682_106121113300027531EstuarineYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0255125_100612793300027534FreshwaterYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDK
Ga0255075_105623113300027578FreshwaterMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0208966_108091933300027586Freshwater LenticKDNRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0209704_119653623300027693Freshwater SedimentIKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0209442_100972393300027732Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0209500_1002085413300027782Freshwater LakeMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEVVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDL
Ga0209500_1018333013300027782Freshwater LakeMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDL
Ga0209990_1006648713300027816Freshwater LakeKKTYQKPEYSGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYETTELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ
Ga0209401_1003591103300027971Freshwater LakeMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0209298_1040909213300027973Freshwater LakeSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKAHRKTQFILNSWKQEIVIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0255257_105305313300028257FreshwaterQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0256301_103836213300029697FreshwaterENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKSHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0315907_1088358313300031758FreshwaterGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYETTELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ
Ga0315900_10015427103300031787FreshwaterMKKTYQKPEYSGKISAYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYETTELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ
Ga0315909_10005263263300031857FreshwaterMKKTYQKPEYSGKISTYQANTKNNNGRVYQQYDADILNPNQNFLYKRALFGLSMYEPAELETMSEAKKERVKKMQRRCQFVLNQWKQEMMISFSNSLFSHFFKNHPFLNPFWEQTEPDPKFVCTLDFKDLGIRKEQIVNKLIETGILPINFYQIQ
Ga0315905_10065146103300032092FreshwaterMTKENKVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSEAKKQRVIKAHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0315902_1072059323300032093FreshwaterMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0315903_1017690213300032116FreshwaterMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0334977_0017931_1397_18613300033978FreshwaterMTKENRVMYSGKLSTYQANTKNFKGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0334992_0021563_1376_19063300033992FreshwaterMIGGVTAPFYFLPHYSNQKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0334996_0141668_400_8643300033994FreshwaterMTKENRVMYSGKLSTYQANTKNLNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVTKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0334991_0013410_225_7523300034013FreshwaterMIGGVTAPFYFYHITLIKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPVNFYQIS
Ga0335019_0258503_409_9363300034066FreshwaterMIGGVTAPFYFYHITLIKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0334990_0028997_1374_18383300034068FreshwaterMTKENRVMYSGKLSTYQSNTKNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEAEQAEMSDAKKQRVIKVHRKTQFILNSWKQEIIIKFSNSLLGHFFKDHPFLNPFWENTDPDPKFVCTLSFKDLGINKKDIIDKLIDCGILPINFYQIT
Ga0335029_0474545_11_4543300034102FreshwaterMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDSGILPINFYQIS
Ga0335049_0399974_169_6333300034272FreshwaterMKKDNRVMYSGKLSTYQANTNNFNGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLSPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDAGILPINFYQIS
Ga0335007_0315176_642_10163300034283FreshwaterMKKENRVMYSGKLSTYQANTKNFKGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLS
Ga0335007_0748590_2_4093300034283FreshwaterTKNFKGKSYQVYDKDPFNPNQNFLYKRAMFGITMYTEEELKEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLSFKDLGINKKDIIDKLIDVGILPVNFYQIS
Ga0335013_0606339_1_4383300034284FreshwaterMIGGVIAPFYFYHITLIKKPHMTKENRVMYSGKLSTYQANTKNFNGKSYQVYDKDPFNPNQNFLYKRAIFGLSMYTEAELTEMSEAKKLRVIKAHRKTQFILNSWKQEMMIKFSNSLLGHFFKDHPFLNPFWENTEPDPKFVCTLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.