Scaffold Ga0209107_10015321

Overview

Basic Information

• Taxon OID: 3300027797
• Scaffold ID: Ga0209107_10015321
• Source Dataset Name: Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4366
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 41.77
  • Long. (^o): -81.73
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080048	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209107_1001532112	F080048	GAGG	MEKILCYCCNKTKNKLNVKKSILMPINLLMCETCISSKFEPRWVVILAGRQLGSEAVREF