NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080048

Metagenome / Metatranscriptome Family F080048

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080048
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 54 residues
Representative Sequence MEKILCYSCNKSKNKLDVKKSSLLPINLLMCETCITSKLEPRWVIILAGRSNG
Number of Associated Samples 101
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.13 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.957 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(14.783 % of family members)
Environment Ontology (ENVO) Unclassified
(40.870 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(57.391 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.75%    β-sheet: 9.88%    Coil/Unstructured: 70.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF02467Whib 40.87
PF05257CHAP 3.48
PF00255GSHPx 0.87
PF00106adh_short 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.91 %
UnclassifiedrootN/A6.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001837|RCM39_1000734All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2264Open in IMG/M
3300001839|RCM40_1079044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium644Open in IMG/M
3300002408|B570J29032_109196530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium631Open in IMG/M
3300002408|B570J29032_109289177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102673Open in IMG/M
3300002408|B570J29032_109418448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium750Open in IMG/M
3300002408|B570J29032_109549708All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium862Open in IMG/M
3300002835|B570J40625_100982374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102723Open in IMG/M
3300003394|JGI25907J50239_1113196All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium527Open in IMG/M
3300003411|JGI25911J50253_10161449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium637Open in IMG/M
3300003430|JGI25921J50272_10055576All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium890Open in IMG/M
3300003497|JGI25925J51416_10065254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium927Open in IMG/M
3300004240|Ga0007787_10273217All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium833Open in IMG/M
3300005662|Ga0078894_10852725All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium793Open in IMG/M
3300005662|Ga0078894_11023844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium709Open in IMG/M
3300005942|Ga0070742_10098459Not Available806Open in IMG/M
3300006484|Ga0070744_10024718All Organisms → Viruses → Predicted Viral1780Open in IMG/M
3300006484|Ga0070744_10080179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium946Open in IMG/M
3300007171|Ga0102977_1025715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1203Open in IMG/M
3300007597|Ga0102919_1022760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1920Open in IMG/M
3300007637|Ga0102906_1076149All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium944Open in IMG/M
3300007649|Ga0102912_1039282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1380Open in IMG/M
3300007658|Ga0102898_1006986All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2533Open in IMG/M
3300007692|Ga0102823_1216994All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium512Open in IMG/M
3300007862|Ga0105737_1036584All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1168Open in IMG/M
3300007862|Ga0105737_1223565All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium501Open in IMG/M
3300007972|Ga0105745_1322534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium508Open in IMG/M
3300007992|Ga0105748_10288267All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium695Open in IMG/M
3300008021|Ga0102922_1102118All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium905Open in IMG/M
3300008108|Ga0114341_10193099All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1832Open in IMG/M
3300008111|Ga0114344_1038811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3196Open in IMG/M
3300008120|Ga0114355_1162484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium776Open in IMG/M
3300008258|Ga0114840_1049857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium662Open in IMG/M
3300008953|Ga0104241_1003618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1121Open in IMG/M
3300008996|Ga0102831_1206794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium649Open in IMG/M
3300009026|Ga0102829_1332470Not Available510Open in IMG/M
3300009185|Ga0114971_10506345All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium675Open in IMG/M
3300010160|Ga0114967_10266516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium891Open in IMG/M
3300010354|Ga0129333_10962335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium719Open in IMG/M
3300012665|Ga0157210_1069202All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium532Open in IMG/M
3300013087|Ga0163212_1136621All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium778Open in IMG/M
3300013372|Ga0177922_10465494All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium510Open in IMG/M
3300017761|Ga0181356_1202315All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium587Open in IMG/M
3300019784|Ga0181359_1105364All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1028Open in IMG/M
3300020048|Ga0207193_1564587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium756Open in IMG/M
3300020074|Ga0194113_10079935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2961Open in IMG/M
3300020074|Ga0194113_10388235All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1030Open in IMG/M
3300020151|Ga0211736_10756349All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300020159|Ga0211734_11257353All Organisms → Viruses → Predicted Viral2302Open in IMG/M
3300020162|Ga0211735_10719294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium668Open in IMG/M
3300020513|Ga0208090_1052323All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium513Open in IMG/M
3300020514|Ga0208202_1032216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium586Open in IMG/M
3300020519|Ga0208223_1028154All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium730Open in IMG/M
3300020519|Ga0208223_1028198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium729Open in IMG/M
3300020541|Ga0208359_1051122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium608Open in IMG/M
3300021961|Ga0222714_10080988All Organisms → Viruses → Predicted Viral2117Open in IMG/M
3300021961|Ga0222714_10112766All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1695Open in IMG/M
3300021962|Ga0222713_10081793All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2358Open in IMG/M
3300021962|Ga0222713_10795553Not Available528Open in IMG/M
3300024306|Ga0255148_1033027All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium955Open in IMG/M
3300024343|Ga0244777_10436438All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium811Open in IMG/M
3300024346|Ga0244775_10408174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1117Open in IMG/M
3300024348|Ga0244776_10319644All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1054Open in IMG/M
3300024512|Ga0255186_1017921All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium960Open in IMG/M
3300024513|Ga0255144_1013610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1416Open in IMG/M
3300024571|Ga0256302_1015078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1723Open in IMG/M
3300024573|Ga0256337_1160543All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium558Open in IMG/M
3300024857|Ga0256339_1027054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1236Open in IMG/M
3300024857|Ga0256339_1030918All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1151Open in IMG/M
3300024865|Ga0256340_1130017Not Available607Open in IMG/M
3300026459|Ga0255170_1088380All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium514Open in IMG/M
3300027114|Ga0208009_1010923All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2231Open in IMG/M
3300027121|Ga0255074_1036148All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium613Open in IMG/M
3300027129|Ga0255067_1060117All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium542Open in IMG/M
3300027197|Ga0208922_1003675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium3342Open in IMG/M
3300027246|Ga0208931_1096517All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium522Open in IMG/M
3300027302|Ga0255096_1027363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1250Open in IMG/M
3300027320|Ga0208923_1068984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium626Open in IMG/M
3300027396|Ga0255146_1012187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1825Open in IMG/M
3300027488|Ga0255084_1000047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage23006Open in IMG/M
3300027563|Ga0209552_1131045All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium654Open in IMG/M
3300027578|Ga0255075_1060599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium672Open in IMG/M
3300027600|Ga0255117_1026166All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1278Open in IMG/M
3300027688|Ga0209553_1230227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium589Open in IMG/M
3300027733|Ga0209297_1254653All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium672Open in IMG/M
3300027757|Ga0208671_10347691All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium519Open in IMG/M
3300027769|Ga0209770_10189138Not Available817Open in IMG/M
3300027772|Ga0209768_10074225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1725Open in IMG/M
3300027797|Ga0209107_10015321Not Available4366Open in IMG/M
3300027816|Ga0209990_10450684All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium551Open in IMG/M
3300027892|Ga0209550_10197302All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1377Open in IMG/M
3300027892|Ga0209550_10448777All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium786Open in IMG/M
3300027963|Ga0209400_1109425All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1269Open in IMG/M
3300027969|Ga0209191_1311584All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium579Open in IMG/M
(restricted) 3300027970|Ga0247837_1239371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium722Open in IMG/M
3300028113|Ga0255234_1087544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium821Open in IMG/M
3300028394|Ga0304730_1175285All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium836Open in IMG/M
3300031784|Ga0315899_10928992All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium781Open in IMG/M
3300031787|Ga0315900_11082884Not Available518Open in IMG/M
3300031951|Ga0315904_10626681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium919Open in IMG/M
3300031951|Ga0315904_11079721All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium628Open in IMG/M
3300031963|Ga0315901_10699115All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium752Open in IMG/M
3300031963|Ga0315901_10855382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium652Open in IMG/M
3300032092|Ga0315905_10835942All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium796Open in IMG/M
3300032093|Ga0315902_10806587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium740Open in IMG/M
3300032116|Ga0315903_10632841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium814Open in IMG/M
3300034021|Ga0335004_0242582All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1097Open in IMG/M
3300034093|Ga0335012_0065869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2068Open in IMG/M
3300034095|Ga0335022_0193702All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1223Open in IMG/M
3300034103|Ga0335030_0779613All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium563Open in IMG/M
3300034108|Ga0335050_0185872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1093Open in IMG/M
3300034116|Ga0335068_0545719All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium530Open in IMG/M
3300034121|Ga0335058_0046169All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium2550Open in IMG/M
3300034166|Ga0335016_0121512All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1832Open in IMG/M
3300034280|Ga0334997_0170711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1440Open in IMG/M
3300034283|Ga0335007_0321947All Organisms → Viruses → Predicted Viral1002Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.48%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.48%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water3.48%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.48%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.74%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.87%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001837Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3aEnvironmentalOpen in IMG/M
3300001839Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3bEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008953Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020514Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020541Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024512Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026459Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027302Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027488Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
RCM39_100073443300001837Marine PlanktonMDRLLCYSCNKNKNKLNSKKSSLLNINLMMCETCIHAKFEPRWVLILAGRQFG
RCM40_107904413300001839Marine PlanktonMDKILCYSCAKSKHKLNVKKSILFDINLLLCESCIENKYEPRWVIILSGRQNGPDSVKDLIL
B570J29032_10919653013300002408FreshwaterMDKILCYSCNKSKNQLHARKSLLLPINLLMCESCVNSKFEPRWVIILSGRSHGPDYVRDF
B570J29032_10928917713300002408FreshwaterMEKVLCYSCNKTKNQLNLRKSTLLPINLLMCETCITSKFEPRWVIILSGRQYGSESVRDFVIK
B570J29032_10941844843300002408FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPDH
B570J29032_10954970843300002408FreshwaterMEKILCYSCNKSKNKLDIKKSTLMPINLFMCESCSSAKLEPRWVIILAGRANGSDHV
B570J40625_10098237413300002835FreshwaterMEKVLCYSCNKTKNQLNLRKSTLLPINLLMCETCITSKFEPRWVIILSGRQYGSE
JGI25907J50239_111319613300003394Freshwater LakeMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISGKLEPRWV
JGI25911J50253_1016144913300003411Freshwater LakeMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCITAKFEPRWVIILSGRQLGPEAVKEF
JGI25921J50272_1005557613300003430Freshwater LakeMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPEHVKEF
JGI25925J51416_1006525443300003497Freshwater LakeMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISGKLEPRWVIILSGRANGSDHVKEYIVR
Ga0007787_1027321713300004240Freshwater LakeMEKILCYSCNKSKNKLDVRKSSLMPINLLICETCNSAKLEPRWVVILAGRSNGPDHVKEF
Ga0078894_1085272513300005662Freshwater LakeMEKILCYSCNKSKNKLDVRKSSLLPINLLICEACHSAKLEPRWVIILAGRQSGSD
Ga0078894_1102384433300005662Freshwater LakeMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRS
Ga0070742_1009845913300005942EstuarineMSEKILCYCCNKTKNSLSAKKSTLLNINLLLCETCIDSKLEPRWVVILAGRQ
Ga0070744_1002471873300006484EstuarineMEKILCYSCNKSKNKLNVKKSILLPINLFMCETCITNKMEPRWVV
Ga0070744_1008017943300006484EstuarineMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCISAKFEPRWVIILSGRQLGPEAVKDF
Ga0102977_102571553300007171Freshwater LakeMDKILCYSCNKTKNKLNAKKSSLLSINLLMCETCVASKFEPRWVIILAGRSNGSD
Ga0102919_102276083300007597EstuarineMEKVLCYSCNKSKANLNLKRSALLAINLLMCETCITSKFEPRWTIILS
Ga0102906_107614933300007637EstuarineMSEKILCYCCNKTKNSLSAKKSTLLNINLLLCETCIDNKLEPRWVVILAGRQIGHEFVKEHV
Ga0102912_103928243300007649EstuarineMSEKILCYCCNKTKNSLSAKKSTLLNINLLLCETCIDNKLEPRWVVILAGRQIGHEFVKEHVS
Ga0102898_1006986103300007658EstuarineMSEKILCYCCNKTKNSLSAKKSTLLNINLLLCETCIDNKLEPRWVVILAGRQ
Ga0102823_121699433300007692EstuarineMEKILCYSCNKSKNKLSVRKSILIPINLLMCETCITAKFEPRWVIILSGRQLGPE
Ga0105737_103658453300007862Estuary WaterMEKILCYSCNKSKANLNLKRSALLPINLLMCETCITSKFEPRWTIILSGRQ
Ga0105737_122356533300007862Estuary WaterMEKILCYCCNKTKNKLNVRKSVLIPINLLMCQTCITSKFEPRWVV
Ga0105745_132253413300007972Estuary WaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPDYV
Ga0105748_1028826733300007992Estuary WaterMEKILCYSCSKTKNQLNAKRSSLLPINLLMCETCITSKFEPRWLIILAGRSNGADYVRD
Ga0102922_110211813300008021EstuarineMEKILCYCCNKTKNKLNLKKSVLIPINLFMCETCISSKFEPRWVI
Ga0114341_1019309913300008108Freshwater, PlanktonMDKILCYSCNKSKNQLHARKSSLLPINLLMCETCVNSKFEPRWVII
Ga0114344_1038811103300008111Freshwater, PlanktonMEKILCASCNKSKNKLSAKRSSLLSINLLMCQTCIDEKLEPKWVIII
Ga0114355_116248443300008120Freshwater, PlanktonMEKILCYSCNKSKNRLDVRKSSLMPINLLICETCNSAKLEPRWVVILAGRSNGPDHVKEF
Ga0114840_104985713300008258Freshwater, PlanktonMEKILCYSCNKSKNKLDVRKSSLMPINLLVCETCNSAKLEPRWVVILAGRSNGPDHVKEFII
Ga0104241_100361853300008953FreshwaterMEKILCYCCNKSKNKLNVKKSSLIPINLFMCETCITSKFEPRWVVIL
Ga0102831_120679413300008996EstuarineMEKILCYSCNKSKNKLEAKKSALLPINLLICETCILSKLEPRWVVILA
Ga0102829_133247023300009026EstuarineMEKVLCYSCNKSKANLNLKRSALLAINLLMCETCITSKFEPRWTIILSGRQYGHESVKEYIA
Ga0114971_1050634513300009185Freshwater LakeMEKILCYCCGQTKHKLNVKKSGLLPINLLMCETCINGKLEPRWVIILSGRSFGSDYVKDF
Ga0114967_1026651643300010160Freshwater LakeMEKVLCYSCNKTKNKLNLKRSSLFTINLLMCEGCISLKYEPRWAIILSGRQN
Ga0129333_1096233533300010354Freshwater To Marine Saline GradientMDKILCYSCNKTKNKLNAKRSALLPINLLMCETCINSKFEPRWVVILAGRQNGIDYVKDFVV
Ga0157210_106920213300012665FreshwaterMEKILCYCCNKSKNQLNARKSALLPVTLLICETCYSSKLEPRWVVI
Ga0163212_113662143300013087FreshwaterMDKILCYSCNKSKHKLNAKKSSLLPINLLMCETCINSKLEPRWVIILAGRSQGADYVREFVLK
Ga0177922_1046549423300013372FreshwaterMEKIMCYSCNKTKNKLNLKRSSLLPINLFLCQTCIDQKMEPRWVVLISGRQNGHEYVKEF
Ga0181356_120231533300017761Freshwater LakeMEKVLCYCCNKSKAALTLKKSALMPINLLLCETCITTKIEPRWVVILSG
Ga0181359_110536413300019784Freshwater LakeMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISGKLEPRF
Ga0207193_156458733300020048Freshwater Lake SedimentMEKILCYSCSKTKNQLNAKRSSLLPINLLMCESCITSKFEPRWLIILAGRSNGADY
Ga0194113_1007993513300020074Freshwater LakeMEKILCYSCGKSKNKLDVKKSVLLPINLLMCETCISSKFEPRWVVILAGRSNGPDHVKEF
Ga0194113_1038823513300020074Freshwater LakeMDKIICYSCNKSKHKLNAKKSSLLPINLLMCETCVNSKLEPRWVIILAGRSQGADYVREFVL
Ga0211736_1075634913300020151FreshwaterMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCISNKFEPRWVIILSGRQ
Ga0211734_1125735383300020159FreshwaterMEKILCYSCNKSKNKLEAKKSSLLPINLLICETCISAKLEPRWVIILSGRS
Ga0211735_1071929413300020162FreshwaterLIEKILCYSCNKNKNKLNLKKSSLLPINLLICETCIDSKFEPRWIIILAGRQMGSEYVR
Ga0208090_105232313300020513FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPEHVK
Ga0208202_103221633300020514FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQ
Ga0208223_102815413300020519FreshwaterMDKVLCYSCNKTKNKLSVKKSSLFQINLLMCETCISSKLEPRWAIILAG
Ga0208223_102819813300020519FreshwaterMEKILCYSCNKSKNKLEVRKSSLLPINLLICEACHSAKLEPRWVIILAG
Ga0208359_105112233300020541FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGR
Ga0222714_1008098863300021961Estuarine WaterMEKILCYSCNKSKNKLDVRKSSLLPINLLICESCHSAKLEPRWVIILSGRA
Ga0222714_1011276613300021961Estuarine WaterMEKILCYSCNKSKANLSLVKSTLLGINLFLCESCKSEKLEPRWVVIIAGRQNGPESV
Ga0222713_1008179383300021962Estuarine WaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPR
Ga0222713_1079555323300021962Estuarine WaterMSEKIFCYSCNKTKNKLNIKKSALLTINLFLCQTCIDNKFEPRWVVLIAGRQNGHEAVKD
Ga0255148_103302743300024306FreshwaterMEKILCYSCNKTKAKLDVKKSSLLPINLLMCETCISSKFEPRWVIILAGRSN
Ga0244777_1043643813300024343EstuarineMEKILCYCCNKTKNKLNLKKSVLIPINLFMCETCISSKFEPRWVIILAGR
Ga0244775_1040817453300024346EstuarineMEKILCYSCSKSKNKLNTRKSALLTINLLMCETCVVSKFEPRWVVILA
Ga0244776_1031964443300024348EstuarineMEKILCYSCSKSKNKLNTRKSALLTINLLMCETCVVSKFEPRWVVILAGRQFGS
Ga0255186_101792143300024512FreshwaterMEKILCYSCNKTKNKLNVRRSSLLPINLFLCQTCIDQKLEPRWVVLISGRQNGHEHVK
Ga0255144_101361013300024513FreshwaterMEKILCYSCNKTKAKLDVKKSSLLPINLLMCETCISSKFEPRWVIILA
Ga0256302_101507813300024571FreshwaterMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISSKLEPRWVVILAGRSNGSD
Ga0256337_116054333300024573FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLLMCESCINSKFEPRWVVILAGRSS
Ga0256339_102705453300024857FreshwaterMDKILCYSCSKSKHKLNAKKSSLLPINLLMCETCINSKLEPRWVIILAGRSNGADHVREFVLK
Ga0256339_103091813300024857FreshwaterMERILCYSCNKSKNKLNVRRSSLLPINLFLCQTCIDQKLEPRWVVLISGRQNGHEHVKEF
Ga0256340_113001733300024865FreshwaterMEKILCYSCNKSKNKLNTKKSSLLTINLLMCETCILSKFEPRWVVILAGRQFGPDH
Ga0255170_108838033300026459FreshwaterMEKILCYSCNKTKNKLNLKKSVLMPINLFMCQTCIEQKYEPRWVIILTGRQSGADTVK
Ga0208009_101092313300027114Deep SubsurfaceMEKILCYSCNKSKNKLDAKKSSLLPINLLICESCISAKLEPRWVVILAGRSQGPD
Ga0255074_103614833300027121FreshwaterMEKILCYSCNKSKNKLDAKKSSLLPINLLICETCISAKLEPRWVIILAGRSQGPDY
Ga0255067_106011733300027129FreshwaterMEKILCYSCNKPKNQLNAKKSMLLPITLLMCETCITSKFEPRWVVILSGRQHGSEFV
Ga0208922_100367513300027197EstuarineMEKILCYCCNKTKNKLNLKKSVLIPINLFMCETCISSKFEPRWVIILAGRQL
Ga0208931_109651733300027246EstuarineMEKILCYSCNKSKNKLSVRKSILIPINLLMCETCITAKFEPRWIII
Ga0255096_102736353300027302FreshwaterMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISSKLEPRWVVILAGRSNGSDYVK
Ga0208923_106898413300027320EstuarineMEKILCYSCNKSKNKLSVRKSILIPINLLMCETCITAKFEPRWVIILSGRQLGPEAVKEFIV
Ga0255146_101218763300027396FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLLMCETCITSKLEPRWVIILAGRSNG
Ga0255084_100004713300027488FreshwaterMEKILCYSCNKSKNKLEAKKSALLPINLLICETCISSKLEPRWVVILAGRSNGSDYV
Ga0209552_113104513300027563Freshwater LakeMEKILCYSCNKSKNKLEAKKSSLLPINLLICETCISGKLE
Ga0255075_106059933300027578FreshwaterMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCITAKLEPRWVII
Ga0255117_102616653300027600FreshwaterMEKILCYCCNKTKNKLNVKKSILMPINLLMCETCISSKFEPRWVVILAGRQLGSEAVRE
Ga0209553_123022713300027688Freshwater LakeMDKVLCYSCNKTKNKLTMKKSTLVSINLLMCESCILSKFEPRWLIILTGRQQGAE
Ga0209297_125465333300027733Freshwater LakeMEKILCYSCNKTKNKLNVRKSILIPINLLMCETCITSKFEPRWVVILAGRQLGSDSVKEF
Ga0208671_1034769133300027757EstuarineMEKILCYSCNKSKNKLSVRKSILIPINLLMCETCITAKFEPRWVVILSGRQLGPEAV
Ga0209770_1018913833300027769Freshwater LakeMEKVLCYSCNKSKANLSLKKSALMGINLLMCDTCISNKFEPRWAVILSGRQYGHES
Ga0209768_1007422513300027772Freshwater LakeMEKVLCYCCNKSKAALTLKKSALMPINLLLCETCITTKIEPRWVVILSGRQYGHEYVKDYVFK
Ga0209107_10015321123300027797Freshwater And SedimentMEKILCYCCNKTKNKLNVKKSILMPINLLMCETCISSKFEPRWVVILAGRQLGSEAVREF
Ga0209990_1045068433300027816Freshwater LakeMEKILCYSCNKSKNKLDVRKSSLLPINLLICETCNSAKLEPRWVVILAGRSSGPD
Ga0209550_1019730253300027892Freshwater LakeMEKVLCYSCNKTKNQLNLRKSTLLPINLLMCETCITSKFEPRWVIILSGRQYGSESV
Ga0209550_1044877713300027892Freshwater LakeMEKILCYSCSKSKNKLEVRKSSLLPINLLICEACHSAKLEPRWVIILAGRQS
Ga0209400_110942513300027963Freshwater LakeMEKILCYSCNKTKNKLNVRKSILIPINLLMCETCISSKFEPRWVVILAG
Ga0209191_131158413300027969Freshwater LakeMEKILCYSCNKTKNQLNVRRSSLLPINLLMCETCISSKFEPRWVIIVAGRQ
(restricted) Ga0247837_123937113300027970FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGP
Ga0255234_108754443300028113FreshwaterMEKILCYSCNKSKNKLDVRKSSLLPINLLICEACHSAKLEPRWVIILAGR
Ga0304730_117528543300028394Freshwater LakeMEKILCYSCNKTKNKLNVRKSILIPINLLMCETCITSKFEPRWVVILAGRQLGSDSVK
Ga0315899_1092899243300031784FreshwaterMEKILCYCCNKTKNKLSLKKSSLIPINLFMCETCISSKFEPRWVIILAGRQLGSDSVKEFII
Ga0315900_1108288433300031787FreshwaterMEKILCYCCNKTKNKLNVKKSILMPINLLMCETCISSKFEPRWVVILAGRQLGSEAV
Ga0315904_1062668113300031951FreshwaterMEKILCYSCNKTKAKLDVKKSTLLPINLLMCESCINSKFEPRWVVILAGRSNGAEHVREV
Ga0315904_1107972113300031951FreshwaterMEKILCYSCNKPKNKLEVRKSGLLPVNLLICETCHTSKLEPRW
Ga0315901_1069911513300031963FreshwaterMDKILCYSCNKSKNQLHAKRSSLLPINLLMCETCIESKFEPRWVIIL
Ga0315901_1085538233300031963FreshwaterMEKILCYSCNKPKNKLEVRKSGLLPVNLLICETCHTSKLEPRWVVILAGRS
Ga0315905_1083594243300032092FreshwaterMEKITCYSCNKSKHKLNVKVSTLLPINLLMCETCINSKFEPRWTIILAGRQKGPEYVR
Ga0315902_1080658743300032093FreshwaterMEKILCYSCNKSKNKLDVRKSSLMPINLLVCETCNSAKLEPRWVV
Ga0315903_1063284113300032116FreshwaterMEKILCYSCNKPKNKLEVRKSGLLPVNLLICETCHTSKLEPRWVVILAGRSHGPEHV
Ga0335004_0242582_3_1703300034021FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPEH
Ga0335012_0065869_1_1773300034093FreshwaterMDKILCYSCNKSKNKLNLKPSGLLNINLLMCETCIESKFEPRWVIILAGRQHGAEFVRE
Ga0335022_0193702_1_1713300034095FreshwaterMEKILCYCCNKPKNKLNVRKSSLLPINLLMCETCITSKFEPRWVIILAGRQIGSDSV
Ga0335030_0779613_380_5623300034103FreshwaterMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPDHVKEY
Ga0335050_0185872_1_1443300034108FreshwaterMEKILCYSCNKSKNNLVVRKSTLLPINLFICETCTASKFEPRWVIILS
Ga0335068_0545719_372_5303300034116FreshwaterMDKILCYSCNKSKNQLHARKSLLLPINLLMCESCVNSKFEPRWVIILSGRSHG
Ga0335058_0046169_2391_25493300034121FreshwaterMSEKIFCYSCNKTKNKLNLKKSSLLTINLFLCQTCIDNKFEPRWVVLIAGRQN
Ga0335016_0121512_1647_18323300034166FreshwaterMSEKILCYSCNKTKNKLNLKRSSLLPINLFMCQTCIDEKMEPRWVVVISGRQNGHESVKEFV
Ga0334997_0170711_1303_14403300034280FreshwaterMDKVLCYSCNKTKNKLSVKKSSLFQINLLMCETCISSKLEPRWAII
Ga0335007_0321947_827_10003300034283FreshwaterMDKVLCYSCNKTKNKLNLKKSTLLPINLFMCDGCIESKFEPRWLVIITGRQNGPESVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.