Basic Information | |
---|---|
Taxon OID | 3300027796 Open in IMG/M |
Scaffold ID | Ga0209373_10314468 Open in IMG/M |
Source Dataset Name | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 635 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Edinburgh | |||||||
Coordinates | Lat. (o) | 55.9225 | Long. (o) | -3.1724 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013428 | Metagenome / Metatranscriptome | 271 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209373_103144682 | F013428 | AGG | MAQGSQTAEQRRRIRRTAILLGVVALAIYVAFIASGVMKAQP |
⦗Top⦘ |