NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209174_10337796

Scaffold Ga0209174_10337796


Overview

Basic Information
Taxon OID3300027789 Open in IMG/M
Scaffold IDGa0209174_10337796 Open in IMG/M
Source Dataset NameWastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)654
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location
Location NameMilwaukee, Wisconsin, USA
CoordinatesLat. (o)43.023Long. (o)-87.895Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033562Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0209174_103377961F033562N/AMSDLALRALLSTAVEQLRDATDLTTDEVIGLRALPPALLTPDVCYSLGVIKGAAAALRLTQREMLEEFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.