Basic Information | |
---|---|
Taxon OID | 3300027779 Open in IMG/M |
Scaffold ID | Ga0209709_10304332 Open in IMG/M |
Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 677 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arctic Ocean: Canada Basin | |||||||
Coordinates | Lat. (o) | 75.235 | Long. (o) | -150.0691 | Alt. (m) | Depth (m) | 79 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027537 | Metagenome | 194 | Y |
F082791 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209709_103043321 | F027537 | N/A | NNMKLNAMIKDPHKSKGDDPKKDMNATYMKSDVRGDVKNGGGTDMSKVNDNPKPMAAMKKINAMYKTEKYLDEKPGSIQSVVAQMYQAEQRTVNLEDNKLDGMVKQYLSKGGVITKLPPALQKGSKPTDMKEHQVGDKGVVKSMKMGEVRDFVSTYNSHFLTNFKAEEFIIKG |
Ga0209709_103043322 | F082791 | AGG | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGM |
⦗Top⦘ |