| Basic Information | |
|---|---|
| Family ID | F082791 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQMLS |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.61 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 95.58 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.027 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.416 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.265 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 73.17% β-sheet: 0.00% Coil/Unstructured: 26.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01327 | Pep_deformylase | 0.88 |
| PF01467 | CTP_transf_like | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.34 % |
| Unclassified | root | N/A | 25.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10060511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1593 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1051953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 610 | Open in IMG/M |
| 3300000949|BBAY94_10079621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 902 | Open in IMG/M |
| 3300001472|JGI24004J15324_10081351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 876 | Open in IMG/M |
| 3300001589|JGI24005J15628_10090162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1055 | Open in IMG/M |
| 3300001589|JGI24005J15628_10169905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 641 | Open in IMG/M |
| 3300001589|JGI24005J15628_10178921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 614 | Open in IMG/M |
| 3300006350|Ga0099954_1049998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 783 | Open in IMG/M |
| 3300006484|Ga0070744_10158614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 648 | Open in IMG/M |
| 3300006749|Ga0098042_1140969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 594 | Open in IMG/M |
| 3300009172|Ga0114995_10170255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1213 | Open in IMG/M |
| 3300009172|Ga0114995_10546547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 633 | Open in IMG/M |
| 3300009420|Ga0114994_10754284 | Not Available | 634 | Open in IMG/M |
| 3300009422|Ga0114998_10564574 | Not Available | 535 | Open in IMG/M |
| 3300009467|Ga0115565_10471334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 565 | Open in IMG/M |
| 3300009481|Ga0114932_10153137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1416 | Open in IMG/M |
| 3300009481|Ga0114932_10211723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1177 | Open in IMG/M |
| 3300009481|Ga0114932_10831109 | Not Available | 535 | Open in IMG/M |
| 3300009512|Ga0115003_10093806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1851 | Open in IMG/M |
| 3300009526|Ga0115004_10681422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 610 | Open in IMG/M |
| 3300009703|Ga0114933_10075364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 2409 | Open in IMG/M |
| 3300009703|Ga0114933_10761322 | Not Available | 619 | Open in IMG/M |
| 3300009703|Ga0114933_10943624 | Not Available | 547 | Open in IMG/M |
| 3300009785|Ga0115001_10751207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 589 | Open in IMG/M |
| 3300009785|Ga0115001_10941585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 518 | Open in IMG/M |
| 3300010883|Ga0133547_11698934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1173 | Open in IMG/M |
| 3300011253|Ga0151671_1025415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 838 | Open in IMG/M |
| 3300012920|Ga0160423_10460373 | Not Available | 867 | Open in IMG/M |
| 3300012928|Ga0163110_10990492 | Not Available | 669 | Open in IMG/M |
| 3300012952|Ga0163180_10143081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1579 | Open in IMG/M |
| 3300012953|Ga0163179_10276954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1318 | Open in IMG/M |
| 3300012953|Ga0163179_11887041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 548 | Open in IMG/M |
| 3300017708|Ga0181369_1019713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1649 | Open in IMG/M |
| 3300017708|Ga0181369_1108881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 571 | Open in IMG/M |
| 3300017713|Ga0181391_1000025 | Not Available | 36292 | Open in IMG/M |
| 3300017713|Ga0181391_1124842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 576 | Open in IMG/M |
| 3300017714|Ga0181412_1074389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 825 | Open in IMG/M |
| 3300017714|Ga0181412_1157707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 508 | Open in IMG/M |
| 3300017724|Ga0181388_1079892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 780 | Open in IMG/M |
| 3300017731|Ga0181416_1133784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 597 | Open in IMG/M |
| 3300017735|Ga0181431_1068612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 798 | Open in IMG/M |
| 3300017738|Ga0181428_1086268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 733 | Open in IMG/M |
| 3300017742|Ga0181399_1028950 | All Organisms → Viruses → Predicted Viral | 1511 | Open in IMG/M |
| 3300017746|Ga0181389_1208753 | Not Available | 503 | Open in IMG/M |
| 3300017748|Ga0181393_1171435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 534 | Open in IMG/M |
| 3300017753|Ga0181407_1080154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 833 | Open in IMG/M |
| 3300017755|Ga0181411_1133167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 722 | Open in IMG/M |
| 3300017757|Ga0181420_1149166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 698 | Open in IMG/M |
| 3300017764|Ga0181385_1032568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1646 | Open in IMG/M |
| 3300017773|Ga0181386_1189243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 621 | Open in IMG/M |
| 3300017779|Ga0181395_1191447 | Not Available | 638 | Open in IMG/M |
| 3300017782|Ga0181380_1266190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 566 | Open in IMG/M |
| 3300017786|Ga0181424_10393302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 565 | Open in IMG/M |
| 3300020248|Ga0211584_1044971 | Not Available | 684 | Open in IMG/M |
| 3300020274|Ga0211658_1032518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1135 | Open in IMG/M |
| 3300020278|Ga0211606_1066193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 713 | Open in IMG/M |
| 3300020294|Ga0211520_1036134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 791 | Open in IMG/M |
| 3300020304|Ga0211684_1049625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 577 | Open in IMG/M |
| 3300020325|Ga0211507_1055686 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300020351|Ga0211601_1077289 | Not Available | 781 | Open in IMG/M |
| 3300020387|Ga0211590_10243072 | Not Available | 565 | Open in IMG/M |
| 3300020395|Ga0211705_10245868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 660 | Open in IMG/M |
| 3300020401|Ga0211617_10211189 | Not Available | 808 | Open in IMG/M |
| 3300020403|Ga0211532_10386676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 525 | Open in IMG/M |
| 3300020404|Ga0211659_10505089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 516 | Open in IMG/M |
| 3300020405|Ga0211496_10341302 | Not Available | 559 | Open in IMG/M |
| 3300020420|Ga0211580_10327755 | Not Available | 628 | Open in IMG/M |
| 3300020429|Ga0211581_10108159 | Not Available | 1122 | Open in IMG/M |
| 3300020433|Ga0211565_10436828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 571 | Open in IMG/M |
| 3300020436|Ga0211708_10164230 | Not Available | 886 | Open in IMG/M |
| 3300020452|Ga0211545_10086121 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300020452|Ga0211545_10276705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 769 | Open in IMG/M |
| 3300020457|Ga0211643_10595747 | Not Available | 542 | Open in IMG/M |
| 3300020459|Ga0211514_10254122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 866 | Open in IMG/M |
| 3300020467|Ga0211713_10212188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 932 | Open in IMG/M |
| 3300020469|Ga0211577_10545662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 697 | Open in IMG/M |
| 3300020470|Ga0211543_10312669 | Not Available | 762 | Open in IMG/M |
| 3300021365|Ga0206123_10354229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 613 | Open in IMG/M |
| 3300022843|Ga0222631_1034014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 687 | Open in IMG/M |
| 3300025120|Ga0209535_1161676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 688 | Open in IMG/M |
| 3300025137|Ga0209336_10127420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 693 | Open in IMG/M |
| 3300025137|Ga0209336_10142717 | Not Available | 639 | Open in IMG/M |
| 3300025138|Ga0209634_1009261 | All Organisms → Viruses | 6033 | Open in IMG/M |
| 3300025138|Ga0209634_1162716 | Not Available | 896 | Open in IMG/M |
| 3300025138|Ga0209634_1202826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 757 | Open in IMG/M |
| 3300025138|Ga0209634_1204814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 751 | Open in IMG/M |
| 3300025138|Ga0209634_1206678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 746 | Open in IMG/M |
| 3300025138|Ga0209634_1283807 | Not Available | 579 | Open in IMG/M |
| 3300025168|Ga0209337_1168464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 927 | Open in IMG/M |
| 3300025168|Ga0209337_1207144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 791 | Open in IMG/M |
| 3300025168|Ga0209337_1212154 | Not Available | 776 | Open in IMG/M |
| 3300025168|Ga0209337_1252938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 673 | Open in IMG/M |
| 3300025508|Ga0208148_1069344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 822 | Open in IMG/M |
| 3300025869|Ga0209308_10322659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 638 | Open in IMG/M |
| 3300027687|Ga0209710_1062726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1616 | Open in IMG/M |
| 3300027752|Ga0209192_10141052 | Not Available | 959 | Open in IMG/M |
| 3300027779|Ga0209709_10304332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 677 | Open in IMG/M |
| 3300027779|Ga0209709_10376143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 572 | Open in IMG/M |
| 3300027788|Ga0209711_10171275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1024 | Open in IMG/M |
| 3300027801|Ga0209091_10203138 | Not Available | 988 | Open in IMG/M |
| 3300027801|Ga0209091_10409680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 612 | Open in IMG/M |
| 3300027813|Ga0209090_10398092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 662 | Open in IMG/M |
| 3300027830|Ga0209359_10028520 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
| 3300028194|Ga0257106_1040760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1787 | Open in IMG/M |
| 3300028194|Ga0257106_1134247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 877 | Open in IMG/M |
| 3300028194|Ga0257106_1156722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 798 | Open in IMG/M |
| 3300028197|Ga0257110_1023863 | All Organisms → Viruses → Predicted Viral | 2720 | Open in IMG/M |
| 3300028197|Ga0257110_1043963 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300028197|Ga0257110_1254376 | Not Available | 653 | Open in IMG/M |
| 3300029318|Ga0185543_1018122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1671 | Open in IMG/M |
| 3300031142|Ga0308022_1104193 | Not Available | 844 | Open in IMG/M |
| 3300031519|Ga0307488_10488457 | Not Available | 738 | Open in IMG/M |
| 3300031599|Ga0308007_10049424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 22.12% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.31% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.31% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.65% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.77% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.77% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.89% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.89% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.89% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.89% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020278 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020304 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556110-ERR599176) | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020351 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX555955-ERR599089) | Environmental | Open in IMG/M |
| 3300020387 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100605112 | 3300000117 | Marine | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIED |
| LP_A_09_P04_10DRAFT_10519532 | 3300000265 | Marine | MKYGKTFTEALKEISKLQEDGHTDVASAVRQCKTAIEDASQM |
| BBAY94_100796211 | 3300000949 | Macroalgal Surface | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQM |
| JGI24004J15324_100813511 | 3300001472 | Marine | MKYGKTFTQALREMSQIQEDGHTDVASAVRQCKTAIEDASEMLSKLQGMNP |
| JGI24005J15628_100901621 | 3300001589 | Marine | MKYGKTFTEALKEISKLQEDGHTDVASAVRQCKTAIEDASQMLSKLQ |
| JGI24005J15628_101699051 | 3300001589 | Marine | MKYKQTFREALKEVGFNLREDGHTDVASAVRQCKTTIEDASQMLSKLQGMSPEDS |
| JGI24005J15628_101789211 | 3300001589 | Marine | MKYTQTFKEALQQVREDGHTDVASAVRQCKTTIEDASQML |
| Ga0099954_10499982 | 3300006350 | Marine | MKYNKTFREALREVSKLKEDGHTDVASAIRKCKTAIEDASQLLSKLQGMDP |
| Ga0070744_101586142 | 3300006484 | Estuarine | MKYNKTFREALKEVGFNLREDGHTDVASAVRQCKTTI |
| Ga0098042_11409692 | 3300006749 | Marine | MKYNKTFREALKEVQKIQEDGHTDVASAIRQNKTSIEDASQMLSKLQSMDPE |
| Ga0114995_101702552 | 3300009172 | Marine | MKYNNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPEGDL |
| Ga0114995_105465472 | 3300009172 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPEGDL |
| Ga0114994_107542842 | 3300009420 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDA |
| Ga0114998_105645741 | 3300009422 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKT |
| Ga0115565_104713342 | 3300009467 | Pelagic Marine | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQMLSKLQGMNPE |
| Ga0114932_101531371 | 3300009481 | Deep Subsurface | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQML |
| Ga0114932_102117231 | 3300009481 | Deep Subsurface | MKYNKTFREALQQVRQIKEDGHTDVASAVRQCKTAIEDASQMLS |
| Ga0114932_108311091 | 3300009481 | Deep Subsurface | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDAS |
| Ga0115003_100938062 | 3300009512 | Marine | MKYNKTFREALKEVGLNLKEDGHTDVASAVRQCKTTMEDASQMLSNFKI* |
| Ga0115004_106814222 | 3300009526 | Marine | VKYKQTFREALQQVREDGHTDVASAVRQCKTTIEDASQMLSKLQGMNP |
| Ga0114933_100753641 | 3300009703 | Deep Subsurface | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQMLS |
| Ga0114933_107613222 | 3300009703 | Deep Subsurface | VKYNKTFKEALQQVREDGHVDVASAIRKCKTSIEDASQ |
| Ga0114933_109436241 | 3300009703 | Deep Subsurface | MKYNKTFKEALRQVREDGHVDVASAIRKCKTSIEDASQLLSKLQTM |
| Ga0115001_107512071 | 3300009785 | Marine | MKYKQTFKEALRQVREDGHTDVASAVRQCKTTIEDA |
| Ga0115001_109415851 | 3300009785 | Marine | MKYNNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPE |
| Ga0133547_116989342 | 3300010883 | Marine | MKYGKTFAQALREMSQIKEDGHTDVASAVRQCKTAIEDASEMLSKLQGMNP |
| Ga0151671_10254153 | 3300011253 | Marine | MKDNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQMLSKLQGMS |
| Ga0160423_104603732 | 3300012920 | Surface Seawater | MKYNKTFREALSEVRKIKEDGHTDVASAIRQNKTSIEDASQMLSK |
| Ga0163110_109904923 | 3300012928 | Surface Seawater | MKYNKTFREALKEVSKLKEDGHTDVASAIRKCKTTI |
| Ga0163180_101430811 | 3300012952 | Seawater | MKYNKTFKEALRQVREDGHVDVASAIRKCKTSIEDASQLLSK |
| Ga0163179_102769542 | 3300012953 | Seawater | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTIEDASQMLS |
| Ga0163179_118870412 | 3300012953 | Seawater | VKYKQTFKEALKQVREDGHTDVASAVRQCKTTIEDASQMLS |
| Ga0181369_10197132 | 3300017708 | Marine | VKYNKTFAEALRQVREDGHTDVASAIRSCKTTIEDAGQMLSKLQMMNP |
| Ga0181369_11088811 | 3300017708 | Marine | MKYNKTFAEALRQVREDGHTDVASAIRSCKTTIEDAGQMLSKLQMMNP |
| Ga0181391_100002542 | 3300017713 | Seawater | MKYSKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIEDASQMLS |
| Ga0181391_11248422 | 3300017713 | Seawater | MKYGKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIEDASQMLS |
| Ga0181412_10743892 | 3300017714 | Seawater | MKYNKTFREALKEVGFNLREDGHTDVASAVRQCKTT |
| Ga0181412_11577072 | 3300017714 | Seawater | MKYSKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIEDAS |
| Ga0181388_10798922 | 3300017724 | Seawater | MKYNKTFAEALRQVREDGHTDVASAIRSCKTTIEDAGQMLSKL |
| Ga0181416_11337842 | 3300017731 | Seawater | MKYGKTFTEALREVSKLQEDGHTDVASAVRQCKTAIEDASEMLSKLQG |
| Ga0181431_10686122 | 3300017735 | Seawater | VKYKQTFKEALQQVREDGHTDVASAVRQCKTTIEDASQMLS |
| Ga0181428_10862682 | 3300017738 | Seawater | MKYNKTFREALREVQSLKEDGHTDVASAVRQCKTAIEDASQMLSKLQGMNPE |
| Ga0181399_10289501 | 3300017742 | Seawater | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTIEDASQISFL |
| Ga0181389_12087532 | 3300017746 | Seawater | MKYNKTFREALREVQSLKEDGHTDVASAVRQCKTAI |
| Ga0181393_11714352 | 3300017748 | Seawater | MKYGKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIE |
| Ga0181407_10801542 | 3300017753 | Seawater | MKYNKTFREALREVQSLKEDGHTDVASAVRQCKTAIEDASQMLSKLQGM |
| Ga0181411_11331672 | 3300017755 | Seawater | MKYSKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIE |
| Ga0181420_11491662 | 3300017757 | Seawater | MKYNKTFREALQQVREDGHTDVASAVRQCKTAIEDASQMLSKLQG |
| Ga0181385_10325682 | 3300017764 | Seawater | MKYTKTFAEALKDVRKIVEDGHTDTASAVRQCKTTIEDAS |
| Ga0181386_11892431 | 3300017773 | Seawater | MKYGKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIEDASQMLSKLQGMNP |
| Ga0181395_11914472 | 3300017779 | Seawater | MKYKQTFKEALQQVREDGHTDVASAVRQCKTAIEDAS |
| Ga0181380_12661901 | 3300017782 | Seawater | MKYGKTFTEALREVSKLKEDGHTDVSSAVRQCKTAIED |
| Ga0181424_103933021 | 3300017786 | Seawater | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTIEDASQMLSKL |
| Ga0211584_10449712 | 3300020248 | Marine | MKYNKTFNEALRQVREDGHVDVASAIRKCKTTIEDAGQLLSKLQTM |
| Ga0211658_10325181 | 3300020274 | Marine | MKYNKTFREALKEVQKIQEDGHTDVASAIRQNKTSIEDASQMLSKLQSMDPEGA |
| Ga0211606_10661932 | 3300020278 | Marine | MRYNKTFREALNEVQKIQEDGHTDVASAIRQCKTSIEDASQMLSKLQTMNPEDA |
| Ga0211520_10361342 | 3300020294 | Marine | MKYTKTFAEALKDVRKIVEDGHTDTASAVRQCKTTIEDASQMLSK |
| Ga0211684_10496251 | 3300020304 | Marine | MKYGKTFTEALREISKLQEDGHTDVASAVRQCKTAIEDASEMLSKLQGMNPEGDL |
| Ga0211507_10556861 | 3300020325 | Marine | MKYNKSFREALKEVAKLKEDGHTDVASAIRQNKTSIEDASQMLS |
| Ga0211601_10772892 | 3300020351 | Marine | MRYNKTFREALDEVKKIEEDGHTDVASAIRQNKTSIEDASQMLSKLQ |
| Ga0211590_102430722 | 3300020387 | Marine | MKYNKTFREALKEVSKLKEDGHTDVSSAVRQCKTVLEDAMQI |
| Ga0211705_102458682 | 3300020395 | Marine | MKYNKTFREALKEVSKLKEDGHTDVASAIRKCKTTIEDASQLLSKLQGM |
| Ga0211617_102111891 | 3300020401 | Marine | MKYNKTFNEALRQVREDGHVDVASAIRKCKTTIEDAGQLLSKLQTMDPEG |
| Ga0211532_103866761 | 3300020403 | Marine | MKYNKTFAEALQQVREDGHTDVASAIRKCKTTIEDAGQLLSKLQ |
| Ga0211659_105050892 | 3300020404 | Marine | MKYNKTFAEALKQVREDGHTDVASAIRSCKTTIEDASQMLSKLQM |
| Ga0211496_103413022 | 3300020405 | Marine | MKYNKTFREALKEVSKLKEDGHTDVASAIRKCKTTIED |
| Ga0211580_103277551 | 3300020420 | Marine | MKYNKTFKEALRQVREDGHVDVASAIRKCKTSIEDASQLLSKLQTMDP |
| Ga0211581_101081591 | 3300020429 | Marine | MRYNKTFREALDEVKKIEEDGHTDVASAIRQNKTSIEDASQMLSKL |
| Ga0211565_104368282 | 3300020433 | Marine | MKYNKTFREALRQVREDGHTDVASAIRSCKTTIEDASQMLSKLQGMNPE |
| Ga0211708_101642302 | 3300020436 | Marine | MKYNKTFTEALREVAKLKEDGHTDVASAIRKCKTAIEDASQLLSKL |
| Ga0211545_100861212 | 3300020452 | Marine | MKYNKTFREALREVQSLKEDGHTDVASAVRQCKTAIED |
| Ga0211545_102767051 | 3300020452 | Marine | MKYNKTFREALREVQSLKEDGHTDVASAVRQCKTAIEDASQM |
| Ga0211643_105957472 | 3300020457 | Marine | MRYNKTFREALDEVKKIEEDGHTDVASAIRQNKTSIEDASQMLSKLQTMDPEG |
| Ga0211514_102541222 | 3300020459 | Marine | MKYNKTFREALKEVQSLKEDGHTDVASAVRQCKTAIEDASQMLSKLQGMDSEGT |
| Ga0211713_102121881 | 3300020467 | Marine | MKYNKTFREALKEVSKLKEDGHTDVASAIRKCKTAIEDASQLLSKLQGMDPEG |
| Ga0211577_105456621 | 3300020469 | Marine | MKYTQSFRKALEEVRQVKEDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPE |
| Ga0211543_103126691 | 3300020470 | Marine | MKYKSFTEALRQVREDGHVDVASAIRKCKTTIEDAGQLLSKLQTM |
| Ga0206123_103542291 | 3300021365 | Seawater | MKYTQTFKEALEEVRQVKEDGHTDVASAVRQCKTAIEDASQMLSKLQGMNP |
| Ga0222631_10340141 | 3300022843 | Saline Water | MKYKQTFKEALRQVREDGHTDVASAVRQCKTTIEDAS |
| Ga0209535_11616762 | 3300025120 | Marine | VKYTQTFREALQQVREDGHTDVASAVRQCKTTIEDASQMLSK |
| Ga0209336_101274201 | 3300025137 | Marine | MKYKQTFKEALRQVREDGHTDVASAVRQCKTTMEDASQMLSKLQ |
| Ga0209336_101427172 | 3300025137 | Marine | MKYTQSFRKALEEVRQVKEDGHTDVASAVRQCKTAIEDASQ |
| Ga0209634_10092614 | 3300025138 | Marine | MKYTQTFREALQQVREDGHTDVASAVRQCKTTIEDASQMLSK |
| Ga0209634_11627161 | 3300025138 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIED |
| Ga0209634_12028261 | 3300025138 | Marine | MKYGKTFTQALREMSQIQEDGHTDVASAVRQCKTAIE |
| Ga0209634_12048142 | 3300025138 | Marine | VKYNKTFREALKEVGFNLREDGHTDVASAVRQCKTTIE |
| Ga0209634_12066781 | 3300025138 | Marine | MKYKQTFKEALRQVREDGHTDVASAVRQCKTTMED |
| Ga0209634_12838071 | 3300025138 | Marine | MKYSNTFREALKQIELNIREDGHTDVASAVRQCKTA |
| Ga0209337_11684642 | 3300025168 | Marine | VKYNKTFREALKEVGFNLREDGHTDVASAVRQCKTTIEDASQ |
| Ga0209337_12071441 | 3300025168 | Marine | MKYGKTFTEALREVSKLQEDGHTDVASAVRQCKTAIEDASQMLS |
| Ga0209337_12121542 | 3300025168 | Marine | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTMEDA |
| Ga0209337_12529382 | 3300025168 | Marine | MKYTQSFRKALEEVRQVKEDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPEG |
| Ga0208148_10693441 | 3300025508 | Aqueous | MKYTQSFREALKEVRQVKEDGHTDVASAVRQCKTAIEDASQM |
| Ga0209308_103226591 | 3300025869 | Pelagic Marine | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTIEDASQM |
| Ga0209710_10627262 | 3300027687 | Marine | MKYNNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQML |
| Ga0209192_101410522 | 3300027752 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIE |
| Ga0209709_103043322 | 3300027779 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGM |
| Ga0209709_103761431 | 3300027779 | Marine | MKYNNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPEG |
| Ga0209711_101712752 | 3300027788 | Marine | MKYNNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSP |
| Ga0209091_102031382 | 3300027801 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDASQ |
| Ga0209091_104096801 | 3300027801 | Marine | MKYKQTFKEALRQVREDGHTDVASAVRQCKTTIEDASQILSKLQGMSSE |
| Ga0209090_103980921 | 3300027813 | Marine | MKYNKTFREALKEVGLNLKEDGHTDVASAVRQCKTTMEDASQMLSKLQDMKQV |
| Ga0209359_100285202 | 3300027830 | Marine | MKYNKTFREALKEVSKLKEDGHTDVASAIRKCKTAIEDASQLLSKLQGMDPE |
| Ga0257106_10407601 | 3300028194 | Marine | MKYNNTFREALKQIEVNIREDGHTDVASAVRQCKTAIEDASQMLSKLQGMSPEGD |
| Ga0257106_11342472 | 3300028194 | Marine | MKYGKTFTEALREVSKLQEDGHTDVASAVRQCKTAIEDASEMLSKLQGMN |
| Ga0257106_11567221 | 3300028194 | Marine | MKYGKTFTQALREMSQIKEDGHTDVASAVRQCKTAIEDASEMLS |
| Ga0257110_10238631 | 3300028197 | Marine | MKYNKTFREALKEVGFNLREDGHTDVASAVRQCKTTIEDASQMLSKLQGMSPEGDLPSWW |
| Ga0257110_10439632 | 3300028197 | Marine | VKYTQTFREALQQVREDGHTDVASAVRQCKTTIEDAS |
| Ga0257110_12543761 | 3300028197 | Marine | MKYSNTFREALKQIELNIREDGHTDVASAVRQCKTAIEDASQ |
| Ga0185543_10181221 | 3300029318 | Marine | MRYTKTFTEALKQVREDGHTDVASAIRQCKTTMEDAS |
| Ga0308022_11041931 | 3300031142 | Marine | MKYGKTFAQALREMSQIKEDGHTDVASAVRQCKTAIEDASEML |
| Ga0307488_104884571 | 3300031519 | Sackhole Brine | MKYKQTFKEALKQVREDGHTDVASAVRQCKTTMED |
| Ga0308007_100494242 | 3300031599 | Marine | MKYGKTFTEALREISKLQEDGHTDVASAVRQCKTAIEDA |
| ⦗Top⦘ |