NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209088_10004298

Scaffold Ga0209088_10004298


Overview

Basic Information
Taxon OID3300027763 Open in IMG/M
Scaffold IDGa0209088_10004298 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8324
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005502Metagenome / Metatranscriptome398N
F020510Metagenome / Metatranscriptome223Y
F081048Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0209088_100042981F005502GGCGGMLLSFIALLGFTTTKLGNALIDLRPIAKKIDVKKIKVRITGYWPGEDEWSSRYQSSTGTRLRAGRHCAVDPDIIPLWSKIRVIGGKREWVAVDTGTAVKSKKASGGKLPVIDVFAASEKQFNAMRLPKVAMVEVMK
Ga0209088_100042984F020510GGAMSLADLLTMFSGRVIGTYTPEQYADCVREARANRHRWGMGQW
Ga0209088_100042986F081048N/AMSVKRLTWQIEILERAKKSLADGRVVVTRCRIDLALHIAKEMLKRAKVYQKRDAEKKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.