Scaffold Ga0209908_10045969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209908_10045969

Scaffold Ga0209908_10045969

Overview

Basic Information
Taxon OID	3300027745 Open in IMG/M
Scaffold ID	Ga0209908_10045969 Open in IMG/M
Source Dataset Name	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	949
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location Name	Sweden: Kiruna
Coordinates	Lat. (^o)	68.3534	Long. (^o)	19.0473	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049312	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209908_100459691	F049312	AGGAGG	MAEPEGGKPSPNPEAAKPAAPGAVDATKYVGTPAVGTSKAAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.