| Basic Information | |
|---|---|
| Family ID | F049312 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAELETDKVNPNPEAAKTPAKPAVDATKYVGTPAVGTSKAAA |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.20 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.367 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.422 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF00762 | Ferrochelatase | 89.80 |
| PF06831 | H2TH | 2.04 |
| PF01149 | Fapy_DNA_glyco | 2.04 |
| PF00180 | Iso_dh | 2.04 |
| PF13432 | TPR_16 | 0.68 |
| PF00355 | Rieske | 0.68 |
| PF01464 | SLT | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 89.80 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 4.08 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_155783 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300001356|JGI12269J14319_10358907 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300001546|JGI12659J15293_10137773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 532 | Open in IMG/M |
| 3300001593|JGI12635J15846_10277956 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300001593|JGI12635J15846_10713428 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300001661|JGI12053J15887_10045942 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300001867|JGI12627J18819_10415473 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300004092|Ga0062389_101514206 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300005435|Ga0070714_100743229 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005602|Ga0070762_10254446 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005614|Ga0068856_101080258 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005921|Ga0070766_10271269 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300006028|Ga0070717_10117823 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300006031|Ga0066651_10080539 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300006102|Ga0075015_100455552 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006174|Ga0075014_100072504 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300006893|Ga0073928_10994071 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300007258|Ga0099793_10533076 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300007788|Ga0099795_10382056 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300007982|Ga0102924_1095803 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300009525|Ga0116220_10371472 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009624|Ga0116105_1065602 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300009683|Ga0116224_10267734 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009764|Ga0116134_1355892 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010046|Ga0126384_10192800 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300010343|Ga0074044_10671435 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300010358|Ga0126370_10892280 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010359|Ga0126376_12089452 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010360|Ga0126372_10949635 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300010361|Ga0126378_10570836 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300010366|Ga0126379_10558094 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300010398|Ga0126383_12271905 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012203|Ga0137399_11640634 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012210|Ga0137378_11676634 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012469|Ga0150984_122645769 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300012685|Ga0137397_11267341 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012929|Ga0137404_10090919 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300012971|Ga0126369_10224678 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300013306|Ga0163162_11949880 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300014654|Ga0181525_10005661 | All Organisms → cellular organisms → Bacteria | 9246 | Open in IMG/M |
| 3300014654|Ga0181525_10827424 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014655|Ga0181516_10413492 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300015241|Ga0137418_11246842 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300016294|Ga0182041_10390447 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300017932|Ga0187814_10450440 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300017959|Ga0187779_11030091 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017970|Ga0187783_10277813 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300017973|Ga0187780_10442015 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300017995|Ga0187816_10120920 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300018006|Ga0187804_10258474 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300018006|Ga0187804_10325242 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018047|Ga0187859_10231677 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300018057|Ga0187858_10958432 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018062|Ga0187784_10374294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300018085|Ga0187772_11444103 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300018086|Ga0187769_10206910 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300018090|Ga0187770_11062195 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300018090|Ga0187770_11478625 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300018090|Ga0187770_11507782 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018468|Ga0066662_12455974 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300019270|Ga0181512_1241243 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300020579|Ga0210407_10587828 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300020580|Ga0210403_11114062 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300020582|Ga0210395_10447531 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300020582|Ga0210395_10506714 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300020583|Ga0210401_10415370 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300021170|Ga0210400_10715607 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300021170|Ga0210400_11580749 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021181|Ga0210388_10921617 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021402|Ga0210385_11413647 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300021406|Ga0210386_10842320 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300021477|Ga0210398_10050939 | All Organisms → cellular organisms → Bacteria | 3401 | Open in IMG/M |
| 3300021478|Ga0210402_11375344 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300021478|Ga0210402_11866494 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021559|Ga0210409_11634914 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021560|Ga0126371_12014677 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300022502|Ga0242646_1010129 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300022507|Ga0222729_1017182 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300022527|Ga0242664_1046184 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300022531|Ga0242660_1028983 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300022531|Ga0242660_1129043 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300022557|Ga0212123_10248841 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300022557|Ga0212123_10646571 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300022722|Ga0242657_1095895 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300022722|Ga0242657_1203186 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300022722|Ga0242657_1218719 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300022732|Ga0224569_101553 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300023250|Ga0224544_1036249 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300024271|Ga0224564_1017173 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025916|Ga0207663_10056950 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300025929|Ga0207664_10324813 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300026294|Ga0209839_10006907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5042 | Open in IMG/M |
| 3300026552|Ga0209577_10761230 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300026557|Ga0179587_10135290 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300026887|Ga0207805_1031047 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027080|Ga0208237_1044683 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027297|Ga0208241_1008349 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300027371|Ga0209418_1076727 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027565|Ga0209219_1035380 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300027603|Ga0209331_1103206 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027696|Ga0208696_1020419 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300027738|Ga0208989_10110395 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300027745|Ga0209908_10045969 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300027824|Ga0209040_10044066 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300027826|Ga0209060_10544450 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027875|Ga0209283_10519266 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027889|Ga0209380_10169124 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300027889|Ga0209380_10190850 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300027889|Ga0209380_10232050 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300027894|Ga0209068_10543101 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027905|Ga0209415_10692494 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300028798|Ga0302222_10244618 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300029999|Ga0311339_11530787 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300030007|Ga0311338_11064405 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300030007|Ga0311338_12008612 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300030506|Ga0302194_10138680 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300030507|Ga0302192_10149710 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300030597|Ga0210286_1106129 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300030617|Ga0311356_11561323 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300030969|Ga0075394_11730881 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031028|Ga0302180_10445221 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031231|Ga0170824_111258509 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031249|Ga0265339_10513190 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031545|Ga0318541_10343800 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031715|Ga0307476_11285211 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031720|Ga0307469_11135740 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031820|Ga0307473_10862125 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031823|Ga0307478_10002302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15221 | Open in IMG/M |
| 3300031823|Ga0307478_10301451 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300031890|Ga0306925_10613855 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300031942|Ga0310916_10268014 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300032076|Ga0306924_11514701 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032180|Ga0307471_103736215 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032205|Ga0307472_102334020 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032770|Ga0335085_12480483 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032783|Ga0335079_10346405 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300032783|Ga0335079_10585709 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032783|Ga0335079_12022120 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032892|Ga0335081_11220941 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300032898|Ga0335072_10570215 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300032898|Ga0335072_11577168 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032954|Ga0335083_11452512 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300033134|Ga0335073_10582683 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300033158|Ga0335077_10370250 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300033289|Ga0310914_11835711 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033433|Ga0326726_11470852 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300033829|Ga0334854_184617 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.04% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.04% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.04% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.36% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.36% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02864120 | 2199352024 | Soil | MAELETGKVDPNPEAPKPAAKPAGDATKYVGTPAVGTSKAAAAGA |
| JGI12269J14319_103589072 | 3300001356 | Peatlands Soil | MAEETGKVSPNPEAAKPAAGAQDATKYVGTPAVGTSKAAAAAG |
| JGI12659J15293_101377731 | 3300001546 | Forest Soil | MPEPEGDKPSPNPEGAKPAPTGALDATKYVGTPAVGTSKAAASAGLSSTGPS |
| JGI12635J15846_102779561 | 3300001593 | Forest Soil | MAEPETPKVNPNPAAAKPAATETQDATKYVGTPAVGTSKAA |
| JGI12635J15846_107134282 | 3300001593 | Forest Soil | MAEPEVPKVNPNPEAAKASAPTGAQDATKYVGTPAVG |
| JGI12053J15887_100459421 | 3300001661 | Forest Soil | MAVPEGEKPVPNPEAVKPVAKPAVDATKYVGTPAVGTSKAAA |
| JGI12627J18819_104154732 | 3300001867 | Forest Soil | MAEPETPKVNPNPAAAKPAAQETQDATKYVGTPALGTSKAAAA |
| Ga0062389_1015142061 | 3300004092 | Bog Forest Soil | MAEPEGAKPSLNPEAAKPAATGAVDATKYVGTPAVGTSKA |
| Ga0070714_1007432292 | 3300005435 | Agricultural Soil | MAELETDKVNPNPESPKTPAKPGADATKYVGTPAVGTSKAAAA |
| Ga0070762_102544461 | 3300005602 | Soil | MAEPEGAKPSPNPEAAKPAAPGAVDATKYVGTPAVGTSKAA |
| Ga0068856_1010802581 | 3300005614 | Corn Rhizosphere | MAELETGKVNPNPDAAKTPAKPTVDATKYVGTPAVGTS |
| Ga0070766_102712692 | 3300005921 | Soil | MAEPEGGSPSPNPEAAKPATTGALNATNYVGTPAVGTSKAAA |
| Ga0070717_101178231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAELETGKVNPNPDAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGIAGTAPSTEVDRHR |
| Ga0066651_100805391 | 3300006031 | Soil | MAELEAPKVNPNPEPAKPAAKPGVDATKYVGTPAVGT |
| Ga0075015_1004555522 | 3300006102 | Watersheds | MAEPETGAVNPNPEAAKPAPKGAADATKYVGTPAVG |
| Ga0075014_1000725041 | 3300006174 | Watersheds | MAETDKVNPNPEVTKPAAKAAVDATKYVGTPAVGTSKAA |
| Ga0073928_109940711 | 3300006893 | Iron-Sulfur Acid Spring | MAEPEGAKPSPNPEAAKPAAPGAVDATKYVGTPAVGTSKAAASAGLS |
| Ga0099793_105330761 | 3300007258 | Vadose Zone Soil | MAVTEGEKPTPNPEAPAPAAKSAVDATKYVGTPAV |
| Ga0099795_103820562 | 3300007788 | Vadose Zone Soil | MTVPEGEKPVPNPEAVKPAAKATVDATKYVGTPAVGTSKAAASAGLNSA |
| Ga0102924_10958031 | 3300007982 | Iron-Sulfur Acid Spring | MAELETGKVNLNPEGAKTPAKPTVDATKYVGTPAVGTSKAAAAGGIAGTAPFT |
| Ga0116220_103714721 | 3300009525 | Peatlands Soil | MAEPETGNVNPNPEAGKPAAKPPVDATKYVGTPAVGTSKAAAAAGVAGTAPST |
| Ga0116105_10656021 | 3300009624 | Peatland | MAELETGKVNPNPEPAKTPANPTVDATKYVGTPAVGTSKAAAAGGIAGTAPSTEIDRH |
| Ga0116224_102677341 | 3300009683 | Peatlands Soil | MAETDKVNPNPEAAKPAAPATAKPAVDAAKYVGTPAVGTSKAA |
| Ga0116134_13558922 | 3300009764 | Peatland | MAEETGKVNPNPEVAKPVAKPAAPGAQDATKYVGTPAVGT |
| Ga0126384_101928001 | 3300010046 | Tropical Forest Soil | MAELETDKVNPNPEPAKTPAKPTVDATKYVGTPAVGTSKA |
| Ga0074044_106714352 | 3300010343 | Bog Forest Soil | MAEPEGGKPTPNPEAAKPAATPAADATKYVGTPAVGTS |
| Ga0126370_108922802 | 3300010358 | Tropical Forest Soil | MAELETDKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAA |
| Ga0126376_120894521 | 3300010359 | Tropical Forest Soil | MAELETGKVNPNPETAKTPAKPASDATKYVGTPAVGTSKAAAAGGVA |
| Ga0126372_109496352 | 3300010360 | Tropical Forest Soil | MAELETDKVNPNPEVAKPAAKPGADATKYVGTPAVGTSKAAAAGGVAGT |
| Ga0126378_105708361 | 3300010361 | Tropical Forest Soil | MAELETDKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAGT |
| Ga0126379_105580942 | 3300010366 | Tropical Forest Soil | MRPPPVWIRASQTEKEEGFMAELETDKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAA |
| Ga0126383_122719051 | 3300010398 | Tropical Forest Soil | MAELETDKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAGTAPFTEI |
| Ga0137399_116406341 | 3300012203 | Vadose Zone Soil | MAEPETEKVNPNPEAAKPAAKPAIDATKYVGTPAVGTSKAAAA |
| Ga0137378_116766342 | 3300012210 | Vadose Zone Soil | MADLETGKVNPNPEVAKPAAKPASDATKYVGTPAVGTSKAAAAGGV |
| Ga0150984_1226457692 | 3300012469 | Avena Fatua Rhizosphere | MAELEAPKVNPNPEPAKPAAKPGVDATKYVGTPAVGTS |
| Ga0137397_112673411 | 3300012685 | Vadose Zone Soil | MAELETGKVNPNPESAKTAAKPTVDATKYVGTPAVGT |
| Ga0137404_100909193 | 3300012929 | Vadose Zone Soil | MAEPEDGKVSPNPEAAKPAPVAPTTAKPATDATKYVGTPAVGTSKAAASA |
| Ga0126369_102246783 | 3300012971 | Tropical Forest Soil | MAELETGKVNPNPEAAKTPAKPAVDATKYVGTPAVGTS |
| Ga0163162_119498802 | 3300013306 | Switchgrass Rhizosphere | MAELEAPKVNPNPEPAKPAAKPGVDATKYVGTPAVG |
| Ga0181525_1000566112 | 3300014654 | Bog | MAEPEGDRPTPNPEAAKPATPGAVDATKYVGTPAVGTSKAAASAGLSS |
| Ga0181525_108274242 | 3300014654 | Bog | MAEPEGAKPTPNPEAAKPAANPATPGAVDATKYVGTPAVGTSKA |
| Ga0181516_104134922 | 3300014655 | Bog | MAEPEGDRPTPNPEAAKPATPGAVDATKYVGTPAVGTSKAAASAGLSSSGPS |
| Ga0137418_112468422 | 3300015241 | Vadose Zone Soil | MAEPEGGNPTPNPDPVQPAPRSTIDATKYVGTPAVGTSKAAAAAGLSST |
| Ga0182041_103904472 | 3300016294 | Soil | MAELEPGKGNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAGTAPS |
| Ga0187814_104504402 | 3300017932 | Freshwater Sediment | MAELETGKVNPNPEAAKTPAKPAVDATKYVGTPAVG |
| Ga0187779_110300912 | 3300017959 | Tropical Peatland | MAELETNKVNPNPEAAKPAAKPAVDATKYVGTPAVGTSK |
| Ga0187783_102778131 | 3300017970 | Tropical Peatland | MAELETDKVNPNPEVAKPGAKPGVDATKYVGTPAVGTSKAAAA |
| Ga0187780_104420152 | 3300017973 | Tropical Peatland | MAETDKVNPSPEAAKPAATVDATKYVGTPAVGTSKAAAAAGVPTTVPSTEIDRR |
| Ga0187816_101209201 | 3300017995 | Freshwater Sediment | MAEETAKVNPNPDVAKPVAKPAAAGAQDATKYVGTPAVGT |
| Ga0187804_102584741 | 3300018006 | Freshwater Sediment | MAEPEGVKPSPNPEAAKPAATGAVDATKYVGTPAVGTSKA |
| Ga0187804_103252421 | 3300018006 | Freshwater Sediment | MAELETGKVNPNPEAAKTPAKPAVDATKYVGTPAVGTSKA |
| Ga0187859_102316772 | 3300018047 | Peatland | MAEPETGKVNPNPEAAKPAAKAAVDATKYVGTPAVGT |
| Ga0187858_109584322 | 3300018057 | Peatland | MAEETGKVDPNPEAVKPVAKTAAPGAQDATKYVGTPAVGTSK |
| Ga0187784_103742942 | 3300018062 | Tropical Peatland | MAETGKVSPTLEAAKAAAPSAADASKYVGTPAVGTS |
| Ga0187772_114441031 | 3300018085 | Tropical Peatland | MADTEKVDVPEAPKAPAKPAVDATKYVGTPAVGTSKAAAAA |
| Ga0187769_102069103 | 3300018086 | Tropical Peatland | MTETDQVKPNPEAAKPAAKGVVDATKYVGTPAVGTSKAA |
| Ga0187770_110621951 | 3300018090 | Tropical Peatland | MAETEQVAPKPEAAKPAAKAAVEATKYVGTPAVGTSRA |
| Ga0187770_114786252 | 3300018090 | Tropical Peatland | MAETGKVISPEAAKPAPSTADATKYVGTPAVGTSKAAAA |
| Ga0187770_115077822 | 3300018090 | Tropical Peatland | MAELETDKVDSNPEVAKPGAKPSVDATKYVGTPAVG |
| Ga0066662_124559742 | 3300018468 | Grasslands Soil | MAELETDKVNPNPDAARPAAKATVDATKYVGTPAVG |
| Ga0181512_12412432 | 3300019270 | Peatland | MAEPETGKVNPNPEAAKPAAKAAVDATKYVGTPAVGTSK |
| Ga0210407_105878281 | 3300020579 | Soil | MAEETGKVNPNPEAAKPVAKPAAPGAQDATKYVGTPAVGT |
| Ga0210403_111140621 | 3300020580 | Soil | MAELETDKVNPNPESPKTPAKPGADATKYVGTPAVGTSKAAAAGGIAGTAPSTEID |
| Ga0210395_104475312 | 3300020582 | Soil | MPEPEGDKPSPNPEGAKPAPTGAMDATKYVGTPAV |
| Ga0210395_105067141 | 3300020582 | Soil | MAELETGNVGPNPEPAKKPASPTVDATKYVGTPAVGTSKAAAAGGVAGTAPS |
| Ga0210401_104153701 | 3300020583 | Soil | MPEPEGDKPSPNPEGAKPAPTGAMDATKYVGTPAVGTSKAAASAG |
| Ga0210400_107156072 | 3300021170 | Soil | MAEPETGKVNPNPEAAKPAVAAAKPAATAGQDATKYVGTPAV |
| Ga0210400_115807491 | 3300021170 | Soil | MAVTEGEKPTPNPEAPAPAAKSAVDATKYVGTPAVGT |
| Ga0210388_109216171 | 3300021181 | Soil | MADPETGKVDPNPEAAKPVAKPAAAVQDATKYVGTPAVGTSKAAAA |
| Ga0210385_114136471 | 3300021402 | Soil | MPEPEGDKPSPNPEGAKPSPTGALDATKYVGTPAVGTSKAAASAGLSSTG |
| Ga0210386_108423201 | 3300021406 | Soil | MAVTEGEKPTPNPEAPAPAAKSAVDATKYVGTPAVGTSK |
| Ga0210398_100509394 | 3300021477 | Soil | MADETGKVDPNPEVAKPVAKPAAPGTQDATKYVGTPAVGTS |
| Ga0210402_113753441 | 3300021478 | Soil | MAEPETDKVNPNPEAAKPAAQGAANATRVDATKYVGTPAVG |
| Ga0210402_118664941 | 3300021478 | Soil | MAEPEDGKVSPNPEAAKPAAPVTPAAAKPAVDATKYV |
| Ga0210409_116349142 | 3300021559 | Soil | MAEPETGKVNPNPEAAKPVAKATADATKYVGTPAVG |
| Ga0126371_120146772 | 3300021560 | Tropical Forest Soil | MAELETDKVNPNPEAAKTPAKPAVDATKYVGTPAVGTSKAAA |
| Ga0242646_10101291 | 3300022502 | Soil | MAEETGKVNPNPEVAKPVAKPAAPAAQDATKYVGTPAVGTSKAAAA |
| Ga0222729_10171821 | 3300022507 | Soil | MAELETDKVNPNPESPKTPAKPGVDATKYVGTPAVGTSKAAAAGGIAGTAPS |
| Ga0242664_10461842 | 3300022527 | Soil | MAELEPDKVNPNPESPKTPAKPGADATKYVGTPAVGTSKAAAAGGIAGTAPSTEIDR |
| Ga0242660_10289831 | 3300022531 | Soil | MAEPEGGKPNPNPEAAKPATAGAMDATKYVGTPAVG |
| Ga0242660_11290431 | 3300022531 | Soil | MAEETGKVNPNPEAPKPVAKPAVPAAQDATKQDATKYVGTPAVGTSKAAAAAGV |
| Ga0212123_102488411 | 3300022557 | Iron-Sulfur Acid Spring | MAELETGKVNLNPEGAKTPAKPTVDATKYVGTPAVGTSKAAAAGGIAGTA |
| Ga0212123_106465711 | 3300022557 | Iron-Sulfur Acid Spring | MAELETNKVNPNPEAAKQPAKPAVDATKYVGTPAVGTSKAAAAGG |
| Ga0242657_10958951 | 3300022722 | Soil | MAELETGNVGPNPEPAKKPASPTVDATKYVGTPAVGTSKAAAAGGVAGT |
| Ga0242657_12031862 | 3300022722 | Soil | MAEETGKVNPNPEAAKPVAKPAAPGAQDATKYVARLR |
| Ga0242657_12187192 | 3300022722 | Soil | MPEPEGDKPSPNPEGAKPAPTGAMDATKYVGTPAVGTSKAAASAGLSST |
| Ga0224569_1015533 | 3300022732 | Rhizosphere | MAEPEGGKPIPNAETVKPAATGAADATKYVGTPAVGTSKAAASAG |
| Ga0224544_10362491 | 3300023250 | Soil | MAEPEGGKPSPNPEAAKPAAPGAVDATKYVGTPAV |
| Ga0224564_10171732 | 3300024271 | Soil | MAEPEGGKPIPNAETVKPAATGAADATKYVGTPAVG |
| Ga0207663_100569501 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAELETDKVNPNPDAAKTPAKPAVDATKYVGTPAVGTSK |
| Ga0207664_103248131 | 3300025929 | Agricultural Soil | MAELETSKVTPNPEVAKPAAKADATKYVGTPAVGTSKAAAAGGIAGT |
| Ga0209839_100069077 | 3300026294 | Soil | MAEPEDGKVSPNPEAAKPAAPMAPAAAKPATDATKYVGTPAVG |
| Ga0209577_107612302 | 3300026552 | Soil | MAELETSKVTPNPEVAKPAAKADATKYVGTPAVGTSKAAAAA |
| Ga0179587_101352901 | 3300026557 | Vadose Zone Soil | MAEPEGGKPTSNPDAAQPAPRSPVDATKYVGTPAV |
| Ga0207805_10310472 | 3300026887 | Tropical Forest Soil | MAEPEAGNVNPNPEAAKSAAKGTADATKYVGTPAVGTSKAA |
| Ga0208237_10446832 | 3300027080 | Forest Soil | MPEPEGAKPTPNPEPAKPAATSAVDATKYVGTPAVGTSKAAAAGGLSSPG |
| Ga0208241_10083493 | 3300027297 | Forest Soil | MPEPEGAKPTPNPEPAKPAATSAVDATKYVGTPAVGT |
| Ga0209418_10767272 | 3300027371 | Forest Soil | MAELETDKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAVAAGGVAGTAPFTEID |
| Ga0209219_10353802 | 3300027565 | Forest Soil | MAEPETPKVNPNPAAAKPAATETQDATKYVGTPAVGTSKAAAFAKVPQCAMPC |
| Ga0209331_11032061 | 3300027603 | Forest Soil | MAVTEGAKPTPNPEAPAPAAKSALDATKYVGTPAVGTSKAAASA |
| Ga0208696_10204194 | 3300027696 | Peatlands Soil | MAEPETDKVNPNPEAAKPAAKAADATKYVGTPAVGTSK |
| Ga0208989_101103951 | 3300027738 | Forest Soil | MAVTEGEKPTPNPEAPAPAAKSAVDATKYVGTPAVGTSKAA |
| Ga0209908_100459691 | 3300027745 | Thawing Permafrost | MAEPEGGKPSPNPEAAKPAAPGAVDATKYVGTPAVGTSKAAA |
| Ga0209040_100440661 | 3300027824 | Bog Forest Soil | MAEPEGGKPSPNPEAAKPGAPSATQGAVDATKYVGTPAVGTSKAAAS |
| Ga0209060_105444501 | 3300027826 | Surface Soil | MADQETGKVNPNPESAKTPANPAADATKYVGTPAVGTSKAAAAGGLAGTAPST |
| Ga0209283_105192662 | 3300027875 | Vadose Zone Soil | MAVQEGEKPVPNPDAVKPVAKATVDATKYVGTPAVGT |
| Ga0209380_101691242 | 3300027889 | Soil | MAEETGKVDPNPEVAKPVAKPAAPGTQDATKYVGTPAVGTSKAAAAA |
| Ga0209380_101908502 | 3300027889 | Soil | MPEPEGAKPTPNPEPAKSAAPSAVDATKYVGTPAVGTSKAAAA |
| Ga0209380_102320502 | 3300027889 | Soil | MAEPEGGKPNPNPEAAKPAAPAAVDATKYVGTPAVETSK |
| Ga0209068_105431012 | 3300027894 | Watersheds | MAELETDKVNPNPEAGKPAKVDATKYVGTPAVGTSK |
| Ga0209415_106924941 | 3300027905 | Peatlands Soil | MTEPETGKVGPNPEATKPAAPSSAPPAAKPAADVTKADATKYVGTPAVGTSKAA |
| Ga0302222_102446182 | 3300028798 | Palsa | MAEPETGTVNPNPEAAKPAAKAAVDATKYVGTPAVGTSKAAA |
| Ga0311339_115307871 | 3300029999 | Palsa | MAEPEGAKPSPNPEAAKPAAPGAVDATKYVGTPAVGTSKAAASAGLSSTGPSNT |
| Ga0311338_110644052 | 3300030007 | Palsa | MAEPEAEKVTPSPEAAKPAAKTPTDATRYVGTPAVGTSKAAAAAGLASPG |
| Ga0311338_120086122 | 3300030007 | Palsa | MAEPESGKPSPNPEAAKPAATGPVDATKYVGTPAVGTSKAAASAGLSS |
| Ga0302194_101386802 | 3300030506 | Bog | MAEPEGVKPIPNPEAAKPAADATKYVGTPAVGTSKAA |
| Ga0302192_101497102 | 3300030507 | Bog | MAEPEGVKPIPNPEAAKPAADATKYVGTPAVGTSKAAASAGLSSSGPSNTDI |
| Ga0210286_11061291 | 3300030597 | Soil | MAEPEGAKPTPNPEAPKPAAPGAVDATKYVGTPAVGTSKAAAAAG |
| Ga0311356_115613231 | 3300030617 | Palsa | MAEPETGTVNPNPEAAKPAAKAAVDATKYVGTPAVGTSKA |
| Ga0075394_117308812 | 3300030969 | Soil | MTDPETGKVNPNPEAAKPVAKPAAPAQDATKYVGTPAVGTSKA |
| Ga0302180_104452212 | 3300031028 | Palsa | MAEPETGTVNPNPEAAKPAAKAAVDATKYVGTPAV |
| Ga0170824_1112585091 | 3300031231 | Forest Soil | MAEPETEKVNPNPTAAKPAAPGGQDATKYVGTPAVGTSKAAAAAGV |
| Ga0265339_105131901 | 3300031249 | Rhizosphere | MAEETGKVNPNPEAAKPAAGAQDATKYVGTPAVGTSKAAAA |
| Ga0318541_103438001 | 3300031545 | Soil | MAELEPGKGNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAG |
| Ga0307476_112852112 | 3300031715 | Hardwood Forest Soil | MAEPETGKVNPNPGAATPAAAKPAPTAVQDATKYVGTP |
| Ga0307469_111357402 | 3300031720 | Hardwood Forest Soil | MAELEAGKANPNPEPVKPAAKPAVDATKYVGTPAVGTSKAVAAGGVA |
| Ga0307473_108621252 | 3300031820 | Hardwood Forest Soil | MAELETDKVNPNPESAKTPAKPTVDATKYVGTPAVGTSKAAAAGGIAGTAPFTEIDR |
| Ga0307478_1000230216 | 3300031823 | Hardwood Forest Soil | MPEPEGDKPSPNPEGAKPAPTGAMDATKYVGTPAVGTSKAA |
| Ga0307478_103014512 | 3300031823 | Hardwood Forest Soil | MPEPEGAKPTPNPEPAKPAATSAVDATKYVGTPAVGTSKAAAAGGL |
| Ga0306925_106138551 | 3300031890 | Soil | MAELEPGKGNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAGTAPSTEIDRHR |
| Ga0310916_102680141 | 3300031942 | Soil | MAELEPGKGNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAGTAPSTEIDRH |
| Ga0306924_115147011 | 3300032076 | Soil | MAELETDKVNPNPEVAKTPAKPKVDASKYVGTPAVGTS |
| Ga0307471_1037362152 | 3300032180 | Hardwood Forest Soil | MAELETDKVNPNPETAKKPASPAVDATKYVGTPAVGTSKAAAAGGIAGT |
| Ga0307472_1023340202 | 3300032205 | Hardwood Forest Soil | MAELETDKVNPNPESAKTPAKPAVDATKYVGTPAV |
| Ga0335085_124804831 | 3300032770 | Soil | MAELETGKVNPNPEAAKTPAKPAADATKYVGTPAVGTSKAAAAGGVAGT |
| Ga0335079_103464051 | 3300032783 | Soil | MSEMETGKSIPNPETAKTASAAAPPAPKPTGDATKYVGTPAVGTSKAAPAAGISGTTPSTEID |
| Ga0335079_105857091 | 3300032783 | Soil | MAELETDKVNPNAEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVAG |
| Ga0335079_120221201 | 3300032783 | Soil | MAELEADKASPNPETAKPAAKPAVDATKYVGTPAVG |
| Ga0335081_112209411 | 3300032892 | Soil | MAELEADKASPNPETAKPAAKPAVDATKYVGTPAVGTSKAAAAGGVA |
| Ga0335072_105702152 | 3300032898 | Soil | MAELETDKVNPNPEPAKTPAKPAVDATKYVGTPAVGTSKAAAAGGVAGT |
| Ga0335072_115771682 | 3300032898 | Soil | MSELETDKVSPNPEAATKPAKPTVDATKYVGTPAVGTSKAAAAGGVAGTAPST |
| Ga0335083_114525122 | 3300032954 | Soil | MAELETNKVNPNPEGAKPAAKPAVDATKYVGTPAVGTSRAAAAGGVAG |
| Ga0335073_105826831 | 3300033134 | Soil | MADTEKVDVPEAPKAPTKPAVDATKYVGTPAVGTSKAVAAAGVSPT |
| Ga0335077_103702503 | 3300033158 | Soil | MAELETGKVNPNPEAAKTPAKPTVDATKYVGTPAVGTSKAAAAGGVA |
| Ga0310914_118357112 | 3300033289 | Soil | MAELETDKVNPNPEVAKTPAKPTVDASKYVGTPAVGTSKAAAAGGVAGTAP |
| Ga0326726_114708521 | 3300033433 | Peat Soil | MAELETDKVNPNPEAAKTPAKPTADATKYVGTPAVGTSKAAAAGGIS |
| Ga0334854_184617_1_114 | 3300033829 | Soil | MAEPESGKPSPNPEAAKPAATGPVDATKYVGTPAVGTS |
| ⦗Top⦘ |