NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209075_1136962

Scaffold Ga0209075_1136962


Overview

Basic Information
Taxon OID3300027711 Open in IMG/M
Scaffold IDGa0209075_1136962 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1053
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)41.7655Long. (o)-111.8143Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043951Metagenome / Metatranscriptome155N
F101100Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0209075_11369622F043951AGGAGMEHLSLGRPIEASLGPRYQCPMCGLKLWTIQAPWTGWQEWYRTEDGRRHYKHRCNIMEDALVMFRWMFGQDW
Ga0209075_11369623F101100AGGAGMKPVFRVESANEEVVRGGWYLLADSLAAAREVYPAHLFPSMTFIEVGKGLCVECNRRAVDALVEER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.