NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209383_1000129

Scaffold Ga0209383_1000129


Overview

Basic Information
Taxon OID3300027672 Open in IMG/M
Scaffold IDGa0209383_1000129 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)53250
Total Scaffold Genes63 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)49 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010848Metagenome / Metatranscriptome298Y
F029484Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0209383_100012957F010848AGGAGMAQTDRRSVAAAEFIGKDVFLKSFQQQSGNISATQLTALVSSVQNLNLSVLKVGTVTTDTVKMIVEGADNLANGDIVGHVIADAAF
Ga0209383_100012958F029484AGGAGMAQANPNAAVRAANGFVGTTFILEVDDVTAVTVAAAVTEAQVEGFIVVAVEGIVSGSHIALQGAGATPSIGGTTLIATFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.