Scaffold Ga0207873_1102240

Overview

Basic Information

• Taxon OID: 3300027664
• Scaffold ID: Ga0207873_1102240
• Source Dataset Name: Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 913
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia

Source Dataset Sampling Location

• Location Name: Berkeley, CA
• Coordinates
  • Lat. (^o): 37.86971
  • Long. (^o): -122.31414

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029294	Metagenome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207873_11022401	F029294	N/A	MKQETGETRDAIVEADEKRIQKILDANNHRKDPYWIVIFAKPAKGCVDGKPTLIKHIKPYAVKPAPQVGMIIGEVNNQKGEILWDVNMPQIPFDFDALRALGAEEANDVVVETTSIPGAYLTR